DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt2 and Sirt4

DIOPT Version :9

Sequence 1:NP_001287422.2 Gene:Sirt2 / 42414 FlyBaseID:FBgn0038788 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001100617.2 Gene:Sirt4 / 304539 RGDID:1310413 Length:319 Species:Rattus norvegicus


Alignment Length:230 Identity:61/230 - (26%)
Similarity:105/230 - (45%) Gaps:61/230 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 RKIVTMVGAGISTSAGIPDFRSPGSGLYSNLKKYELPHPTAIFDLDYFEKNPAPFFALAKELYPG 143
            :|::.|.||||||.:||||:||...|||:...:..:.|      :|:....|     :.:..:..
  Rat    60 KKLLVMTGAGISTESGIPDYRSEKVGLYARTDRRPIQH------IDFIRSAP-----VRQRYWAR 113

  Fly   144 SFI---------PTPAHYFIRLLNDKGLLQRHYTQNIDTLDRLTGLPEDKIIEAHGSFHTNHCIK 199
            :|:         |.|||:.:......|.|....|||:|.|....|  ..::.|.||..|...|:.
  Rat   114 NFVGWPQFSSHQPNPAHWALSNWEKLGKLHWLVTQNVDALHSKAG--NQRLTELHGCMHRVLCLS 176

  Fly   200 CRKEY---------------------------DMDWMKAEIFADRLPKCQKCQGVVKPDIVFFGE 237
            |.::.                           |:...:.::.:.|:|.|.:|.|.:|||:||||:
  Rat   177 CGEQTARRVLQDRFQALNPSWSAEAQGVAPDGDVFLTEEQVRSFRVPCCDRCGGPLKPDVVFFGD 241

  Fly   238 NLPKRFYSSPEE-DF-----QDCDLLIIMGTSLEV 266
            .:      :|:: ||     ::.|.|:::|:||:|
  Rat   242 TV------NPDKVDFVHQRVKEADSLLVVGSSLQV 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt2NP_001287422.2 SIRT1 79..330 CDD:238699 61/230 (27%)
Sirt4NP_001100617.2 SIRT4 52..313 CDD:238700 61/230 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.