DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt2 and Sirt7

DIOPT Version :9

Sequence 1:NP_001287422.2 Gene:Sirt2 / 42414 FlyBaseID:FBgn0038788 Length:386 Species:Drosophila melanogaster
Sequence 2:XP_008766699.1 Gene:Sirt7 / 303745 RGDID:1305876 Length:426 Species:Rattus norvegicus


Alignment Length:393 Identity:95/393 - (24%)
Similarity:140/393 - (35%) Gaps:120/393 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LGGSSDAKEEVK--VEKVIPDLSFDGFAEHWR---------VHGFRKIVTMVGAGISTSAGIPDF 98
            |.|.|..:|.:|  .|:|..|      .|..|         |...|.:|...||||||:|.|||:
  Rat    62 LQGRSRRREGLKRRQEEVCDD------PEELRRKVRELAGAVRSARHLVVYTGAGISTAASIPDY 120

  Fly    99 RSPGSGLYSNLKKYELPHPTAIFDLDYFEKNPAPFFALAKELYPGSFIPTPAHYFIRLLNDKGLL 163
            |.| :|:::.|:|   ..|.:..||...|                   ||..|..|..|:...|:
  Rat   121 RGP-NGVWTLLQK---GRPVSAADLSEAE-------------------PTLTHMSITQLHKHKLV 162

  Fly   164 QRHYTQNIDTLDRLTGLPEDKIIEAHGSFH------------------------TNHCIKC--RK 202
            |...:||.|.|...:|||...|.|.||:.:                        ...|..|  .:
  Rat   163 QHVVSQNCDGLHLRSGLPRTAISELHGNMYIEVSSAQRTQGLGDKQMSLTVPSLPQVCTSCIPNR 227

  Fly   203 EYDMDWMKAEIF--ADRLP--------KCQKCQGVVKPDIVFFGE----NLPKRFYSSPEEDFQD 253
            ||      ..:|  .:|..        .|.||...::..||.|||    ..|.. :.:..|....
  Rat   228 EY------VRVFDVTERTALHRHLTGRTCHKCGTQLRDTIVHFGERGTLGQPLN-WEAATEAASK 285

  Fly   254 CDLLIIMGTSLEVQPFASLVW---RPGPRCIRLLINRDAVGQASCVLFMDPNTRSLLFDKPNNTR 315
            .|.::.:|:||:|......:|   :|..|..:|.|                  .:|.:...::..
  Rat   286 ADTILCLGSSLKVLKKYPRLWCMTKPPSRRPKLYI------------------VNLQWTPKDDWA 332

  Fly   316 DVAFLGDCDAGVMALAKALG--------WDQELQQLITSERKKLSGSQNSEELQQGKEKP----Q 368
            .:...|.||..:..|...||        |...:..|.|..|....||.:.:.|.:.:|:|    |
  Rat   333 ALKLHGKCDDVMRLLMDELGLEIPVYNRWQDPIFSLATPLRAGEEGSHSRKSLCRSREEPPPGDQ 397

  Fly   369 SDP 371
            |.|
  Rat   398 SAP 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt2NP_001287422.2 SIRT1 79..330 CDD:238699 69/293 (24%)
Sirt7XP_008766699.1 SIRT7 102..339 CDD:238701 65/284 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.