DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt2 and hst4

DIOPT Version :9

Sequence 1:NP_001287422.2 Gene:Sirt2 / 42414 FlyBaseID:FBgn0038788 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_593659.1 Gene:hst4 / 2542366 PomBaseID:SPAC1783.04c Length:415 Species:Schizosaccharomyces pombe


Alignment Length:362 Identity:105/362 - (29%)
Similarity:157/362 - (43%) Gaps:93/362 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 RKIVTMVGAGISTSAGIPDFRSPGSGLYSNLK-KYELP-HPTAIFDLDYFE--KNPAPFFALAKE 139
            ::||.:.|||||..|||||||| ..||:|:|: :|:|. ....:||...:.  |:...|.|:.::
pombe    58 KRIVVVTGAGISCDAGIPDFRS-SEGLFSSLRAEYKLNCSGKELFDGSVYRDLKSVNIFHAMIRK 121

  Fly   140 LY--PGSFIPTPAHYFIRLLNDKGLLQRHYTQNIDTLD-RLTGL----------PEDKIIEAHGS 191
            |:  ..:..||..|.|:..|..:..|.|.||||||.|: ||.||          |....|..||:
pombe   122 LHMLSNNARPTDFHLFLSQLAQESKLLRLYTQNIDFLETRLEGLQTCIPLPQSAPWPTTIPLHGT 186

  Fly   192 FHTNHCIKCR--KEYDMDWMKAEIFADR--LPKCQKC----------------QGVVKPDIVFFG 236
            .....|.:|.  |:::.|     || ||  :..|..|                :|.::|.||.:.
pombe   187 LEVVSCTRCSFLKKFNPD-----IF-DRNGVTVCPDCKTENEVRRIAGKRSVIEGCLRPRIVLYN 245

  Fly   237 ENLP--KRFYSSPEEDFQ---DCDLLIIMGTSLEVQPFASLVWRPGPRCIRLLINRDAVGQASCV 296
            |..|  :...|...:|.:   ||  ||:.|||.::         ||       :.|.....::||
pombe   246 EIHPDSESIGSVCSQDLKSRPDC--LIVAGTSCKI---------PG-------VKRIIKEMSNCV 292

  Fly   297 LFMDPNTRSLLFDKPNNTRDVAFLGDCDAGVMA-LAKALGWDQELQQLITSERKKLSGSQNSEEL 360
            .....|...|.:|:|  |:|  ||..||..|.. |..|:   :.|:.|:.:...||    .|...
pombe   293 HKQKGNVIWLNYDEP--TKD--FLNLCDLVVQGDLQIAI---RRLKPLLDAPSWKL----KSHSA 346

  Fly   361 QQGKEKPQSDPDKMT--------------SGDRDKKD 383
            ::..::..|:..|:|              |.|..|||
pombe   347 KRTSKQKSSEQTKITSSTKITKAIGLNTKSNDSSKKD 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt2NP_001287422.2 SIRT1 79..330 CDD:238699 90/293 (31%)
hst4NP_593659.1 SIR2 50..339 CDD:223915 94/312 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000643
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.