DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt2 and SIRT3

DIOPT Version :9

Sequence 1:NP_001287422.2 Gene:Sirt2 / 42414 FlyBaseID:FBgn0038788 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001357239.1 Gene:SIRT3 / 23410 HGNCID:14931 Length:417 Species:Homo sapiens


Alignment Length:337 Identity:163/337 - (48%)
Similarity:212/337 - (62%) Gaps:34/337 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GGSSDAKEEVKVEKVIPDLSFDGFAEHWRVHGFRKIVTMVGAGISTSAGIPDFRSPGSGLYSNLK 110
            |||||..:          ||....||..|....:::|.||||||||.:||||||||||||||||:
Human   115 GGSSDKGK----------LSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQ 169

  Fly   111 KYELPHPTAIFDLDYFEKNPAPFFALAKELYPGSFIPTPAHYFIRLLNDKGLLQRHYTQNIDTLD 175
            :|:||:|.|||:|.:|..||.|||.||||||||::.|...|||:|||:|||||.|.||||||.|:
Human   170 QYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLE 234

  Fly   176 RLTGLPEDKIIEAHGSFHTNHCIKCRKEYDMDWMKAEIFADRLPKCQKCQGVVKPDIVFFGENLP 240
            |::|:|..|::||||:|.:..|..|::.:..:.::|::.|||:|:|..|.||||||||||||.||
Human   235 RVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLP 299

  Fly   241 KRFYSSPEEDFQDCDLLIIMGTSLEVQPFASLVWRPGPRCIRLLINRDAVGQASCVLFMDPNTRS 305
            :||... ..||...|||:|:||||||:|||||.........|||||||.||.    |...|    
Human   300 QRFLLH-VVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGP----LAWHP---- 355

  Fly   306 LLFDKPNNTRDVAFLGDCDAGVMALAKALGWDQELQQLITSERKKLSGSQNSEELQQGKEKPQSD 370
                   .:||||.|||...||.:|.:.|||.:|::.|:..|..|:   |.:||     :.|:..
Human   356 -------RSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKV---QTAEE-----DHPRGC 405

  Fly   371 PDKMTSGDRDKK 382
            |...:..|...|
Human   406 PSHCSRLDGPDK 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt2NP_001287422.2 SIRT1 79..330 CDD:238699 138/250 (55%)
SIRT3NP_001357239.1 SIRT1 138..373 CDD:238699 138/250 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54280
OrthoDB 1 1.010 - - D512963at33208
OrthoFinder 1 1.000 - - FOG0000643
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101879
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R577
SonicParanoid 1 1.000 - - X1602
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.