DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt2 and sir-2.3

DIOPT Version :9

Sequence 1:NP_001287422.2 Gene:Sirt2 / 42414 FlyBaseID:FBgn0038788 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_510220.1 Gene:sir-2.3 / 185876 WormBaseID:WBGene00004802 Length:287 Species:Caenorhabditis elegans


Alignment Length:232 Identity:62/232 - (26%)
Similarity:90/232 - (38%) Gaps:64/232 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 KIVTMVGAGISTSAGIPDFRSPGSGLYSNLKKYELPHPTA---IFDLDYFEKNPA---------- 131
            |::.:.||||||.:||||:||...|||:.         ||   |:..|:.:....          
 Worm    29 KLLIITGAGISTESGIPDYRSKDVGLYTK---------TALEPIYFQDFMKSKKCRQRYWSRSYL 84

  Fly   132 --PFFALAKELYPGSFIPTPAHYFIRLLNDKGLLQRHYTQNIDTLDRLTGLPEDKIIEAHGSFHT 194
              |.||.|        :|...||.:.............|||:|.|....|  ...|.|.||:...
 Worm    85 NWPRFAQA--------LPNFNHYALSKWEAANKFHWLITQNVDGLHLKAG--SKMITELHGNALQ 139

  Fly   195 NHCIKCR-------------------KEYDMDWMKAEIFAD-----------RLPKCQKCQGVVK 229
            ..|..|.                   ||..:...:.|:.||           ::|:|..|.|::|
 Worm   140 VKCTSCEYIETRQTYQDRLNYANPGFKEQFVSPGQQELDADTALPLGSEQGFKIPECLNCGGLMK 204

  Fly   230 PDIVFFGENLPKRFYSSPEEDFQDCDLLIIMGTSLEV 266
            .|:..|||||.........:...:|:.::.:||||||
 Worm   205 TDVTLFGENLNTDKIKVCGKKVNECNGVLTLGTSLEV 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt2NP_001287422.2 SIRT1 79..330 CDD:238699 62/232 (27%)
sir-2.3NP_510220.1 SIRT4 20..284 CDD:238700 62/232 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.