Sequence 1: | NP_001287422.2 | Gene: | Sirt2 / 42414 | FlyBaseID: | FBgn0038788 | Length: | 386 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_510220.1 | Gene: | sir-2.3 / 185876 | WormBaseID: | WBGene00004802 | Length: | 287 | Species: | Caenorhabditis elegans |
Alignment Length: | 232 | Identity: | 62/232 - (26%) |
---|---|---|---|
Similarity: | 90/232 - (38%) | Gaps: | 64/232 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 80 KIVTMVGAGISTSAGIPDFRSPGSGLYSNLKKYELPHPTA---IFDLDYFEKNPA---------- 131
Fly 132 --PFFALAKELYPGSFIPTPAHYFIRLLNDKGLLQRHYTQNIDTLDRLTGLPEDKIIEAHGSFHT 194
Fly 195 NHCIKCR-------------------KEYDMDWMKAEIFAD-----------RLPKCQKCQGVVK 229
Fly 230 PDIVFFGENLPKRFYSSPEEDFQDCDLLIIMGTSLEV 266 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sirt2 | NP_001287422.2 | SIRT1 | 79..330 | CDD:238699 | 62/232 (27%) |
sir-2.3 | NP_510220.1 | SIRT4 | 20..284 | CDD:238700 | 62/232 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |