DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4360 and CG4854

DIOPT Version :9

Sequence 1:NP_650879.1 Gene:CG4360 / 42413 FlyBaseID:FBgn0038787 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_650860.1 Gene:CG4854 / 42391 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster


Alignment Length:442 Identity:96/442 - (21%)
Similarity:140/442 - (31%) Gaps:178/442 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 MKIHTDERPYKCKHC-----DKAFRQIS-TLTNHVKIHTG----EKP----FTCNICA------- 204
            |..:.|.|..||:.|     |::..... ...:.:|..||    |.|    ..|..||       
  Fly     1 MHTNVDSRDLKCRICLVQPKDESLMPTEPDFPDKIKRCTGVELSESPDWPNRICTSCALLLRAAL 65

  Fly   205 ----------KDFRQQSTL-INHIKTHKAAESSTPTSL--LNYQPQTGSGKHRKSQMHQAYQQQH 256
                      ||.::|... ||....|...|:...|..  |:....|||    .|::...|...:
  Fly    66 KLRSLCQQTEKDLKEQKLQEINIEIVHDEQETKKKTESRDLSKNEATGS----DSELEYEYLDSY 126

  Fly   257 QRVQISKTLYSGSYSSPAAEELVKPFQCSVCKRRFPQLSTLHNHERTH-IDPKP----------- 309
                 ..||.|....:.:|:|||     |:    .|.:|.  ..|..: :.|||           
  Fly   127 -----DVTLESSEDVACSADELV-----SI----EPAISA--PEESVYSLSPKPVTFEDEDSGQA 175

  Fly   310 --YKCETCDKSFSQLATLANHKKIHTGDKPYTCSYCHMQFRQQSTLTNHLKTHTHQIAPGGVGGA 372
              :.|..|:..:|:...|.||.|:|:..||:.|..||.:|||...|..|:.|||           
  Fly   176 ASFTCNICNNVYSERVKLTNHMKVHSAKKPHECEICHKRFRQTPQLARHMNTHT----------- 229

  Fly   373 GGGGGAVTATVDHSMPAPLAPGTQQLTSGLLPNNLHGSTANIIQLDHHPLLHFLDGSTTVSSVVA 437
                                                                             
  Fly   230 ----------------------------------------------------------------- 229

  Fly   438 TAAANTKVEHFQAGGSPSGRMTVVGTINMLKGDNPDRPFGCSVCQRFFSQQSTLVNHIKTHTGEK 502
                                              .:||:.|..|...|:..||.:.|.:.||.|:
  Fly   230 ----------------------------------GNRPYKCDYCDSRFADPSTRIKHQRIHTNER 260

  Fly   503 PYKCKICEVNFRQVATLNNHMKIHTGEKPYNCSFCPKQFRQKSTLQNHLRVH 554
            ||||:.|..:|.....|..|:|.||||:|::|.:|.|.|.|.....:|.:.|
  Fly   261 PYKCEFCSRSFGYSNVLRVHLKTHTGERPFSCQYCQKSFSQLHHKNSHEKSH 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4360NP_650879.1 C2H2 Zn finger 144..164 CDD:275368 1/2 (50%)
zf-H2C2_2 157..181 CDD:290200 7/24 (29%)
C2H2 Zn finger 172..192 CDD:275368 4/25 (16%)
zf-H2C2_2 185..209 CDD:290200 10/48 (21%)
C2H2 Zn finger 200..220 CDD:275368 8/37 (22%)
C2H2 Zn finger 284..304 CDD:275368 4/19 (21%)
zf-C2H2_8 287..363 CDD:292531 27/89 (30%)
C2H2 Zn finger 312..332 CDD:275368 7/19 (37%)
C2H2 Zn finger 340..360 CDD:275368 8/19 (42%)
C2H2 Zn finger 478..498 CDD:275368 6/19 (32%)
zf-H2C2_2 491..515 CDD:290200 10/23 (43%)
C2H2 Zn finger 506..526 CDD:275368 6/19 (32%)
zf-H2C2_2 519..543 CDD:290200 12/23 (52%)
C2H2 Zn finger 534..554 CDD:275368 6/19 (32%)
CG4854NP_650860.1 zf-AD 12..>57 CDD:285071 9/44 (20%)
C2H2 Zn finger 180..200 CDD:275368 7/19 (37%)
zf-H2C2_2 193..217 CDD:290200 11/23 (48%)
COG5048 201..>258 CDD:227381 22/166 (13%)
C2H2 Zn finger 208..228 CDD:275368 8/19 (42%)
zf-H2C2_2 221..244 CDD:290200 9/132 (7%)
C2H2 Zn finger 236..256 CDD:275368 6/19 (32%)
zf-H2C2_2 251..273 CDD:290200 10/21 (48%)
C2H2 Zn finger 264..284 CDD:275368 6/19 (32%)
zf-H2C2_2 277..301 CDD:290200 12/23 (52%)
C2H2 Zn finger 292..312 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471451
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.