DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4360 and pad

DIOPT Version :9

Sequence 1:NP_650879.1 Gene:CG4360 / 42413 FlyBaseID:FBgn0038787 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_650534.2 Gene:pad / 41981 FlyBaseID:FBgn0038418 Length:924 Species:Drosophila melanogaster


Alignment Length:475 Identity:98/475 - (20%)
Similarity:150/475 - (31%) Gaps:175/475 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GGGGGGSNGGS-----------GPGPNSGQQQ---------PTTLASLQQSPFALHQLTAVQAI- 78
            |...|||||.|           .|.|...|||         ||..::.|.:...|...|.:..: 
  Fly   519 GPSSGGSNGTSTNEFKRLITQTKPQPQVKQQQTAGLSASGAPTATSANQAAMQRLSSNTTITKVP 583

  Fly    79 ------------QHPTHQAMLHPQHPLVHLLDISTTTANSGGGGGGSHTPIS------------- 118
                        .:|....||:.|:..:..:.:.|...........|.||.|             
  Fly   584 KQPASLPAPAPTSNPAKLPMLNKQNITISRISMQTAPKAQSKPSTTSPTPASQPIPVSVPALSQA 648

  Fly   119 ---PMKQEVQSVI---------SEEEV--------VVDDPRKKKQ----------------CHVC 147
               |:..:.:.::         |.::|        ::..|:::.|                |..|
  Fly   649 QPPPLAAQHKKIVRKPPENQDTSGQKVKAARPPQQILPSPQQEGQNATHSGSEAPTTSGLICPTC 713

  Fly   148 KNKFRQLTTLRNHMKIHTDERPYKCKH--CDKAFRQISTLTNHVKIHTGEKPFTCNICAKDFRQQ 210
            |.:|::...|..|:|:|...||:||..  |||.|.:...|:.|:..|:|:|.:||.:|.|.|.::
  Fly   714 KREFKKKEHLTQHVKLHAGLRPFKCSEEGCDKTFSRKEHLSRHLVSHSGQKMYTCEVCKKPFSRK 778

  Fly   211 STLINHIKTHKAAESSTPTSLLNYQPQTGSGKHRKSQMHQAYQQQHQRVQISKTLYSGSYSSPAA 275
            ..|..|.:.|      |.||                               ::|||.        
  Fly   779 DNLNKHRRIH------TQTS-------------------------------TETLYC-------- 798

  Fly   276 EELVKPFQCSVCKRRFPQLSTLHNHERTHIDPKPYKCETCDKSFSQLATLANHKKIHTGDKPYTC 340
                    |.||.:.|........|...|...:|........:....|....|.: ..|..|...
  Fly   799 --------CDVCNKNFATKLHYEKHREMHKKIRPESAAPGATASPAAAPALTHVR-SNGQVPNKA 854

  Fly   341 SYCHMQFRQ-QSTLTN-------HLKTHTHQIAPGGVGGAGGGGGAVTATVDHSMPAPLAPGTQQ 397
            .:...|.|. |.|.|.       |:.| |..:|          |..:|.|     .||       
  Fly   855 VFEIKQERSAQQTQTQQPPAQVMHVVT-TQDLA----------GNTITIT-----QAP------- 896

  Fly   398 LTSGLLPNNLHGSTANIIQL 417
                  .:|:.||.||.:||
  Fly   897 ------DSNMPGSLANYVQL 910

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4360NP_650879.1 C2H2 Zn finger 144..164 CDD:275368 7/19 (37%)
zf-H2C2_2 157..181 CDD:290200 12/25 (48%)
C2H2 Zn finger 172..192 CDD:275368 7/21 (33%)
zf-H2C2_2 185..209 CDD:290200 10/23 (43%)
C2H2 Zn finger 200..220 CDD:275368 6/19 (32%)
C2H2 Zn finger 284..304 CDD:275368 5/19 (26%)
zf-C2H2_8 287..363 CDD:292531 17/83 (20%)
C2H2 Zn finger 312..332 CDD:275368 2/19 (11%)
C2H2 Zn finger 340..360 CDD:275368 6/27 (22%)
C2H2 Zn finger 478..498 CDD:275368
zf-H2C2_2 491..515 CDD:290200
C2H2 Zn finger 506..526 CDD:275368
zf-H2C2_2 519..543 CDD:290200
C2H2 Zn finger 534..554 CDD:275368
padNP_650534.2 zf-AD 16..87 CDD:214871
C2H2 Zn finger 710..730 CDD:275368 7/19 (37%)
zf-C2H2 736..760 CDD:278523 8/23 (35%)
C2H2 Zn finger 738..760 CDD:275368 7/21 (33%)
zf-H2C2_2 752..777 CDD:290200 10/24 (42%)
zf-C2H2 766..788 CDD:278523 7/21 (33%)
C2H2 Zn finger 768..788 CDD:275368 6/19 (32%)
zf-H2C2_2 780..808 CDD:290200 13/80 (16%)
C2H2 Zn finger 799..819 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.