| Sequence 1: | NP_650879.1 | Gene: | CG4360 / 42413 | FlyBaseID: | FBgn0038787 | Length: | 556 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001247055.1 | Gene: | CG6808 / 41394 | FlyBaseID: | FBgn0037921 | Length: | 375 | Species: | Drosophila melanogaster |
| Alignment Length: | 195 | Identity: | 55/195 - (28%) |
|---|---|---|---|
| Similarity: | 78/195 - (40%) | Gaps: | 56/195 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 170 YKCKHCDKAFRQISTLTNHVKIHTGEKPFTCNICAKDFRQQSTLINHIKTHKAAESSTPTSLLNY 234
Fly 235 QPQTGSGKHRKSQMHQAYQQQHQRVQISKTLYSGSYSSPAAEELVKPFQCSVCKRRFPQLSTLHN 299
Fly 300 HERTHIDPKPYKCETCDKSFSQLATLANHKKIHTGDKPYTCSYCHMQFRQQSTLTNHLKTHTHQI 364
Fly 365 364 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4360 | NP_650879.1 | C2H2 Zn finger | 144..164 | CDD:275368 | |
| zf-H2C2_2 | 157..181 | CDD:290200 | 4/10 (40%) | ||
| C2H2 Zn finger | 172..192 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 185..209 | CDD:290200 | 9/23 (39%) | ||
| C2H2 Zn finger | 200..220 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 284..304 | CDD:275368 | 10/19 (53%) | ||
| zf-C2H2_8 | 287..363 | CDD:292531 | 28/75 (37%) | ||
| C2H2 Zn finger | 312..332 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 340..360 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 478..498 | CDD:275368 | |||
| zf-H2C2_2 | 491..515 | CDD:290200 | |||
| C2H2 Zn finger | 506..526 | CDD:275368 | |||
| zf-H2C2_2 | 519..543 | CDD:290200 | |||
| C2H2 Zn finger | 534..554 | CDD:275368 | |||
| CG6808 | NP_001247055.1 | zf-AD | 9..79 | CDD:214871 | |
| C2H2 Zn finger | 229..249 | CDD:275368 | 7/19 (37%) | ||
| zf-C2H2 | 255..277 | CDD:278523 | 7/21 (33%) | ||
| C2H2 Zn finger | 257..277 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 269..293 | CDD:290200 | 13/79 (16%) | ||
| C2H2 Zn finger | 285..305 | CDD:275368 | 10/19 (53%) | ||
| zf-H2C2_2 | 299..321 | CDD:290200 | 9/21 (43%) | ||
| C2H2 Zn finger | 313..333 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 341..359 | CDD:275368 | 7/17 (41%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45471449 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.840 | |||||