DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4360 and esg

DIOPT Version :9

Sequence 1:NP_650879.1 Gene:CG4360 / 42413 FlyBaseID:FBgn0038787 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_476600.1 Gene:esg / 34903 FlyBaseID:FBgn0001981 Length:470 Species:Drosophila melanogaster


Alignment Length:407 Identity:84/407 - (20%)
Similarity:124/407 - (30%) Gaps:172/407 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 HLNHATAATAAMANYQHYQL---------PASHGGGGGGGGGGGGGGGSNGGSGPGPN------S 51
            |::..||......|.|.:|:         |:|             ...|.|...|.|:      :
  Fly   134 HMSPYTAEFYRTINQQGHQILPLRGDLIAPSS-------------PSDSLGSLSPPPHHYLHGRA 185

  Fly    52 GQQQPTTLASLQQSPFALHQLTAVQAIQHPTHQAMLHPQHPLVHLLDISTTTANSGGGGGGSHT- 115
            ....|...:.:...|..:.|           |:.:.:||.|....|            ||.:|| 
  Fly   186 SSVSPPMRSEIIHRPIGVRQ-----------HRFLPYPQMPGYPSL------------GGYTHTH 227

  Fly   116 ----PISPMKQE-----VQSVISEE---------------------------------------E 132
                ||||...|     ::|:..|.                                       |
  Fly   228 HHHAPISPAYSENSYYSMRSMTPESSCSSSLPEDLSLKHKNLNLNLNTSQPGEQAAAKTGDMSPE 292

  Fly   133 VVVDDPRKKK-------QCHVCKNKFRQLTTLRNHMKIHTD-------ERPYKCKHCDKAFRQIS 183
            .:.:...||.       ||..|:..:...:.|..|.:.|..       ::.:.||.|||.:..:.
  Fly   293 TMPNASAKKDKNQPPRYQCPDCQKSYSTFSGLTKHQQFHCPAAEGNQVKKSFSCKDCDKTYVSLG 357

  Fly   184 TLTNHVKIHTGEKPFTCNICAKDFRQQSTLINHIKTHKAAESSTPTSLLNYQPQTGSGKHRKSQM 248
            .|..|::.||  .|..||:|.|.|.:...|..||:||                 ||.        
  Fly   358 ALKMHIRTHT--LPCKCNLCGKAFSRPWLLQGHIRTH-----------------TGE-------- 395

  Fly   249 HQAYQQQHQRVQISKTLYSGSYSSPAAEELVKPFQCSVCKRRFPQLSTLHNHERTHIDPKPYKCE 313
                                           |||.|..|.|.|...|.|..|.:||.|.|.|.|.
  Fly   396 -------------------------------KPFSCQHCHRAFADRSNLRAHLQTHSDIKKYSCT 429

  Fly   314 TCDKSFSQLATLANHKK 330
            :|.|:||:::.|..|.:
  Fly   430 SCSKTFSRMSLLTKHSE 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4360NP_650879.1 C2H2 Zn finger 144..164 CDD:275368 4/19 (21%)
zf-H2C2_2 157..181 CDD:290200 8/30 (27%)
C2H2 Zn finger 172..192 CDD:275368 7/19 (37%)
zf-H2C2_2 185..209 CDD:290200 10/23 (43%)
C2H2 Zn finger 200..220 CDD:275368 8/19 (42%)
C2H2 Zn finger 284..304 CDD:275368 7/19 (37%)
zf-C2H2_8 287..363 CDD:292531 18/44 (41%)
C2H2 Zn finger 312..332 CDD:275368 7/19 (37%)
C2H2 Zn finger 340..360 CDD:275368
C2H2 Zn finger 478..498 CDD:275368
zf-H2C2_2 491..515 CDD:290200
C2H2 Zn finger 506..526 CDD:275368
zf-H2C2_2 519..543 CDD:290200
C2H2 Zn finger 534..554 CDD:275368
esgNP_476600.1 zf-C2H2 309..331 CDD:278523 5/21 (24%)
C2H2 Zn finger 311..331 CDD:275370 4/19 (21%)
zf-C2H2 344..366 CDD:278523 7/21 (33%)
C2H2 Zn finger 346..366 CDD:275368 7/19 (37%)
zf-C2H2 370..392 CDD:278523 8/21 (38%)
C2H2 Zn finger 372..392 CDD:275368 8/19 (42%)
zf-H2C2_2 385..408 CDD:290200 13/78 (17%)
zf-C2H2 398..420 CDD:278523 8/21 (38%)
C2H2 Zn finger 400..420 CDD:275368 7/19 (37%)
C2H2 Zn finger 428..444 CDD:275368 6/15 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.