DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4360 and klf-1

DIOPT Version :9

Sequence 1:NP_650879.1 Gene:CG4360 / 42413 FlyBaseID:FBgn0038787 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_497632.1 Gene:klf-1 / 175404 WormBaseID:WBGene00018990 Length:497 Species:Caenorhabditis elegans


Alignment Length:421 Identity:92/421 - (21%)
Similarity:152/421 - (36%) Gaps:118/421 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 FRQQSTLINHIKTHKAAESSTPTSLLNYQPQTGSGKHRKSQMHQAYQQQHQRVQISKTLYSGSYS 271
            |.:||. .:....:|.:...:..||  :||.| |...|..|:...:..:||:   |.:.:|| ::
 Worm   121 FERQSD-FSAFAPYKNSHFDSTQSL--FQPTT-SFNDRLEQIKSDFIAEHQK---SMSSFSG-FN 177

  Fly   272 SPAAEELVKPFQ-CSVCKRRFPQLSTLHNHERT----HI-------DPKPYKCETCDKSFSQLAT 324
            :|.. .|...|| ..|.|..|..:....|.:..    |:       ||.|       :|.:....
 Worm   178 TPTT-ALGAAFQGMQVKKSAFAPVLLRENLDTRRPGGHLISDILNRDPLP-------QSRNLNLN 234

  Fly   325 LANH---KKIHTGDKPYTCSYCHMQFRQQSTLTNHLKTHTHQIAPGGVGGAGGGGGAVTATVDHS 386
            :|.:   :.||:                         |....||....|.:|..........|..
 Worm   235 MARNVPIRLIHS-------------------------TSNFDIASSSSGDSGHQDHESIVVEDAD 274

  Fly   387 MPAPLAPGTQQ-----------LTSGL--------LPNNLHGSTANIIQLDHHPLLHF---LDGS 429
            |.:|.:|..::           ||..:        ||:::..|..:.:..:..| |.|   :|..
 Worm   275 MDSPTSPCVKRSAMNFDLRDEPLTVNVESVSSTSDLPSSVSSSVNSFVYQNFDP-LEFKRKIDEL 338

  Fly   430 TTVSSVVATAAANTKV-----------------EHFQAGGSPSGRMTVVGTINMLKGDN----PD 473
            |..:.:.....||.:|                 ||.......|.|:.|..:   |:..|    |.
 Worm   339 TASACLAVMPDANGQVDPMAIKTQLDAIKKQMEEHQTHMAEASQRLHVDSS---LEDSNCEPSPS 400

  Fly   474 RPFGCSV-------------CQRFFSQQSTLVNHIKTHTGEKPYKCKI--CEVNFRQVATLNNHM 523
            ..:..|.             |.:.:::.|.|..|.:||||||||:|..  |:..|.:...|..|.
 Worm   401 SSYDASEPSVKRLHHCTHPNCGKVYTKSSHLKAHFRTHTGEKPYECSWDGCDWRFARSDELTRHY 465

  Fly   524 KIHTGEKPYNCSFCPKQFRQKSTLQNHLRVH 554
            :.|||::|:.||.|.:.|.:...|..|::.|
 Worm   466 RKHTGDRPFKCSQCSRAFSRSDHLSLHMKRH 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4360NP_650879.1 C2H2 Zn finger 144..164 CDD:275368
zf-H2C2_2 157..181 CDD:290200
C2H2 Zn finger 172..192 CDD:275368
zf-H2C2_2 185..209 CDD:290200 1/1 (100%)
C2H2 Zn finger 200..220 CDD:275368 3/12 (25%)
C2H2 Zn finger 284..304 CDD:275368 4/23 (17%)
zf-C2H2_8 287..363 CDD:292531 12/89 (13%)
C2H2 Zn finger 312..332 CDD:275368 2/22 (9%)
C2H2 Zn finger 340..360 CDD:275368 0/19 (0%)
C2H2 Zn finger 478..498 CDD:275368 5/32 (16%)
zf-H2C2_2 491..515 CDD:290200 13/25 (52%)
C2H2 Zn finger 506..526 CDD:275368 5/21 (24%)
zf-H2C2_2 519..543 CDD:290200 10/23 (43%)
C2H2 Zn finger 534..554 CDD:275368 6/19 (32%)
klf-1NP_497632.1 COG5048 398..>481 CDD:227381 26/82 (32%)
C2H2 Zn finger 419..438 CDD:275368 4/18 (22%)
zf-H2C2_2 430..457 CDD:290200 13/26 (50%)
C2H2 Zn finger 446..468 CDD:275368 5/21 (24%)
zf-H2C2_2 460..485 CDD:290200 10/24 (42%)
C2H2 Zn finger 476..496 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.