DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42668 and KES1

DIOPT Version :9

Sequence 1:NP_001189250.2 Gene:CG42668 / 42412 FlyBaseID:FBgn0261550 Length:990 Species:Drosophila melanogaster
Sequence 2:NP_015180.1 Gene:KES1 / 855958 SGDID:S000006066 Length:434 Species:Saccharomyces cerevisiae


Alignment Length:344 Identity:105/344 - (30%)
Similarity:155/344 - (45%) Gaps:61/344 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   483 DLSKVVLPTFILEPRS--------------FLDK--LSDSYYHADLLSKAVQEDDAFTRMKLVVQ 531
            |||.:..|.|||.|.|              ||:.  ::|..|....|.....|.....||..|.:
Yeast    23 DLSSLSAPPFILSPISLTEFSQYWAEHPELFLEPSFINDDNYKEHCLIDPEVESPELARMLAVTK 87

  Fly   532 WYLSS----FYKKPKGL---KKPYNPILGERFRCYW---QHPSGSRTFYIAEQVSHHPPVSAFYV 586
            |::|:    :..:.:.|   |||.||.|||.|...|   :||....|..::|||||||||:||.:
Yeast    88 WFISTLKSQYCSRNESLGSEKKPLNPFLGELFVGKWENKEHPEFGETVLLSEQVSHHPPVTAFSI 152

  Fly   587 TNRED-----GF-----SITCSILAKSKFYGNSTSAVLEGAATMTLLP-RGECYTATTPYAHCKG 640
            .|.::     |:     |.|.|::...|.:|:            |:|. :.|.|..|.|..|.:|
Yeast   153 FNDKNKVKLQGYNQIKASFTKSLMLTVKQFGH------------TMLDIKDESYLVTPPPLHIEG 205

  Fly   641 ILMGTLSMELGGKINIECENTGYRTELEFKLKPFLGGADATNVVVGKI-------KLGKETLATI 698
            ||:.:..:||.||..|: .:||....:||..:.:..|  ..|....:|       |..::.|.||
Yeast   206 ILVASPFVELEGKSYIQ-SSTGLLCVIEFSGRGYFSG--KKNSFKARIYKDSKDSKDKEKALYTI 267

  Fly   699 NGHWDKECRVKDSKTGEETVLFKVDAETRSKRLTRYMVPLDLQEANESQRLWQRVSEAIANEDQV 763
            :|.|....::..:...||:.||...|...::.|.  :.||:.|...||::.|..|:.||...|..
Yeast   268 SGQWSGSSKIIKANKKEESRLFYDAARIPAEHLN--VKPLEEQHPLESRKAWYDVAGAIKLGDFN 330

  Fly   764 AATEEKTVLEERQRADAKE 782
            ...:.||.|||.||...||
Yeast   331 LIAKTKTELEETQRELRKE 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42668NP_001189250.2 PH_OPR5_ORP8 231..361 CDD:270103
PH 238..356 CDD:278594
Oxysterol_BP 471..796 CDD:279564 105/344 (31%)
Prefoldin <849..943 CDD:238453
KES1NP_015180.1 Oxysterol_BP 12..363 CDD:395990 105/344 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345160
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R635
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.