DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42668 and CG9205

DIOPT Version :9

Sequence 1:NP_001189250.2 Gene:CG42668 / 42412 FlyBaseID:FBgn0261550 Length:990 Species:Drosophila melanogaster
Sequence 2:NP_612075.1 Gene:CG9205 / 38113 FlyBaseID:FBgn0035181 Length:224 Species:Drosophila melanogaster


Alignment Length:188 Identity:41/188 - (21%)
Similarity:65/188 - (34%) Gaps:50/188 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 SELMNSLQDPAVIVLADWL-KVRGTLKSWTKLWCVL--KPGLLLIYKSQKT-------KSSHWV- 279
            |.|...:::.|.:.|...| |....:|.|...|..:  |.|.|..|....:       .|.|.: 
  Fly     3 SNLNRIIRESAKLKLCGQLSKYTNVMKGWQYRWFTVDAKTGSLSYYLCDSSTVGDDIAPSPHVLA 67

  Fly   280 ----GTVMLTSCQVIERPSKKDGFCFKLFHPLEQSI------------WAPRGPDKETIGAVVQ- 327
                |.|.|....|.  ||.:|...|.:......::            |.      :.:.|||: 
  Fly    68 SAPRGQVQLAGAVVY--PSDEDSRTFAIACASGDTVKLRANDARARQEWV------DGLRAVVES 124

  Fly   328 -----------PLPTAYLIFRAPSQAAGKCWMDALELSLRCSALLLRSNSSTGTAPTS 374
                       |||...|:..:.:..:.:   .||.|:.:|:|.|.|:..|...|..|
  Fly   125 HMKAMDISNSSPLPPRELLAASDAMVSAR---QALFLTEQCNASLARAIESIDCASFS 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42668NP_001189250.2 PH_OPR5_ORP8 231..361 CDD:270103 34/168 (20%)
PH 238..356 CDD:278594 31/156 (20%)
Oxysterol_BP 471..796 CDD:279564
Prefoldin <849..943 CDD:238453
CG9205NP_612075.1 PH 15..123 CDD:278594 23/115 (20%)
PH_ORP10_ORP11 17..135 CDD:270106 24/125 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460428
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.