DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42668 and OSBPL11

DIOPT Version :9

Sequence 1:NP_001189250.2 Gene:CG42668 / 42412 FlyBaseID:FBgn0261550 Length:990 Species:Drosophila melanogaster
Sequence 2:NP_073613.2 Gene:OSBPL11 / 114885 HGNCID:16397 Length:747 Species:Homo sapiens


Alignment Length:658 Identity:180/658 - (27%)
Similarity:269/658 - (40%) Gaps:178/658 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 YKSQKT---KSSHWVGTVMLTSCQVIE---------------------------RPSKKDGFCFK 302
            ||.:.|   :..|||..:.:.:....|                           |||:.....|.
Human   133 YKLRATDAKERQHWVSRLQICTQHHTEAIGKNNPPLKSRSFSLASSSNSPISQRRPSQNAISFFN 197

  Fly   303 LFHPLEQSIWA------------------PRGPDKETIGAVVQPLPTA---------YLIFRAPS 340
            :.|...||:..                  ..|..::.|.. ::.|||:         .|:.:|.|
Human   198 VGHSKLQSLSKRTNLPPDHLVEVREMMSHAEGQQRDLIRR-IECLPTSGHLSSLDQDLLMLKATS 261

  Fly   341 QAAGKCWMDALELSLRCSALLLRSNSSTGTAPTSSYIGEPLPVSHETQWSE-----ADYEKHFND 400
            .|...|..|...:     ..|..::...|:.|:.:.|          :|.|     :::.|:..|
Human   262 MATMNCLNDCFHI-----LQLQHASHQKGSLPSGTTI----------EWLEPKISLSNHYKNGAD 311

  Fly   401 HDLDADSQ------NEAPNAVMSGLESESESDPAEPAQDDVVDQQCVETSYVPFTEEEFGEQGEQ 459
            .....|..      .|.|.| .|||.:.   :|.|...||.::..|      ...|::.|     
Human   312 QPFATDQSKPVAVPEEQPVA-ESGLLAR---EPEEINADDEIEDTC------DHKEDDLG----- 361

  Fly   460 VEELAEENKSLIWCIVKQVRPGMDLSKVVLPTFILEPRSFLDKLSDSYYHADLLSKAVQEDDAFT 524
               ..||.:|:|..::.|::.||||::|||||||||.||.|:..:|...|.||.........|..
Human   362 ---AVEEQRSVILHLLSQLKLGMDLTRVVLPTFILEKRSLLEMYADFMSHPDLFIAITNGATAED 423

  Fly   525 RMKLVVQWYLSSFYKKPKG--LKKPYNPILGERFRCYWQHPS----------------------- 564
            ||...|::||:||::..||  .|||||||:||.|.|.|:.|.                       
Human   424 RMIRFVEYYLTSFHEGRKGAIAKKPYNPIIGETFHCSWKMPKSEVASSVFSSSSTQGVTNHAPLS 488

  Fly   565 -------GSRTF---YIAEQVSHHPPVSAFYVTNREDGFSITCSILAKSKFYGNSTSAVLEGAAT 619
                   ||..:   ::|||||||||||.||....|....:...:..||||.|.|....:.|...
Human   489 GESLTQVGSDCYTVRFVAEQVSHHPPVSGFYAECTERKMCVNAHVWTKSKFLGMSIGVTMVGEGI 553

  Fly   620 MTLLPRGECYTATTPYAHCKGILMGTLS-MELGGKINIECENTGYRTELEFKLKPFLGGA----- 678
            ::||..||.||.:.|.|:.:.||  |:. :|||||:::.|..|||...:.|..|||.||.     
Human   554 LSLLEHGEEYTFSLPCAYARSIL--TVPWVELGGKVSVNCAKTGYSASITFHTKPFYGGKLHRVT 616

  Fly   679 -----DATNVVVGKIKLGKETLATINGHWDKECRVKDSKTGEETVLFKVDAETRSKRLTRYMV-- 736
                 :.||.||.:::          |.|:.......|           :.||:...||:..|  
Human   617 AEVKHNITNTVVCRVQ----------GEWNSVLEFTYS-----------NGETKYVDLTKLAVTK 660

  Fly   737 ----PLDLQEANESQRLWQRVSEAIANEDQVAATEEKTVLEERQRADAKERLSSDSVHMPDLFEL 797
                ||:.|:..||:|||:.|::::...:...|||.|..||||||.:.:.|..:.:......|..
Human   661 KRVRPLEKQDPFESRRLWKNVTDSLRESEIDKATEHKHTLEERQRTEERHRTETGTPWKTKYFIK 725

  Fly   798 DSYGQWLY 805
            :..| |:|
Human   726 EGDG-WVY 732

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42668NP_001189250.2 PH_OPR5_ORP8 231..361 CDD:270103 25/149 (17%)
PH 238..356 CDD:278594 25/144 (17%)
Oxysterol_BP 471..796 CDD:279564 126/376 (34%)
Prefoldin <849..943 CDD:238453
OSBPL11NP_073613.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50
PH_ORP10_ORP11 61..167 CDD:270106 7/33 (21%)
PH 63..153 CDD:278594 6/19 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..188 1/29 (3%)
Oxysterol_BP 372..732 CDD:279564 128/383 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 689..714 11/24 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D949920at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R635
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.