DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4367 and CG42598

DIOPT Version :9

Sequence 1:NP_001287421.2 Gene:CG4367 / 42409 FlyBaseID:FBgn0038783 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001163857.2 Gene:CG42598 / 8674042 FlyBaseID:FBgn0260997 Length:340 Species:Drosophila melanogaster


Alignment Length:200 Identity:84/200 - (42%)
Similarity:122/200 - (61%) Gaps:15/200 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GHGMMLSPTGRSSRWRYDNSAPTNYDDNALYCGGFWKQTE-NDGKCGLCGDDWSLEQPRPNELGG 86
            |||.::.|.||:|.||:....|.:|:|:.|.|||..:|.: |.||||.|||.|.|.:|||:|.||
  Fly    29 GHGRLVEPPGRASAWRFGFQTPPDYNDHELNCGGLSRQWQRNGGKCGECGDAWDLPEPRPHEYGG 93

  Fly    87 KYGSGVIVKSFAGVDEAEINVKITANHLGYFRFHICDLDENGSESEDCFNQYPLNFTDGS----- 146
            .:|.|.||:|:....:..|.|::||:|:|||.|.||   .|.:..:.|.::..|:..:||     
  Fly    94 HWGKGQIVRSYLPGSQMTIRVELTASHMGYFEFRIC---PNPNAKQSCLDENVLSILNGSPSQPN 155

  Fly   147 -----QKYYINTTTGDIPVTVKLPSDLNCIHCVLRWTYTAGNNWGVCEDGTGAMGCGAQETFINC 206
                 .::|....:....:..:|| |..|.||||:|.|.||||||:|.:|.||:|||.||.|.:|
  Fly   156 ESDLDTRFYPRNGSCIYEILAQLP-DFTCEHCVLQWRYVAGNNWGMCGNGIGAIGCGPQEEFRSC 219

  Fly   207 ADISV 211
            :||::
  Fly   220 SDIAL 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4367NP_001287421.2 LPMO_10 24..209 CDD:335201 81/195 (42%)
CG42598NP_001163857.2 Chitin_bind_3 30..222 CDD:281112 81/195 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447022
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1283095at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21113
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.