DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4367 and CG42749

DIOPT Version :9

Sequence 1:NP_001287421.2 Gene:CG4367 / 42409 FlyBaseID:FBgn0038783 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001188545.1 Gene:CG42749 / 31438 FlyBaseID:FBgn0261803 Length:345 Species:Drosophila melanogaster


Alignment Length:214 Identity:82/214 - (38%)
Similarity:128/214 - (59%) Gaps:13/214 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MGF---LNRMGELEGHGMMLSPTGRSSRWRYDNSAPTNYDDNALYCGGF---WKQTENDGKCGLC 70
            :||   :..|..:.|||.::.|..|::.||:....|.||:||.|:|||:   |:|  |.|:||:|
  Fly    20 LGFVVLMQLMASVRGHGRLMDPPARNAMWRFGYPNPVNYNDNELFCGGYAVQWEQ--NKGRCGIC 82

  Fly    71 GDDWSLEQPRPNELGGKYGSGVIVKSFAGVDEAEINVKITANHLGYFRFHICDLDENGSE-SEDC 134
            ||.:.::.|||:|.||:|..|:|.:.:......::.|::||||.|.|...:|..:....| ::.|
  Fly    83 GDAYHVKSPRPHEAGGQYAKGIISRYYTAGQTIDVEVELTANHYGRFEMFLCPNNNPRQEATQQC 147

  Fly   135 FNQYPLNFTDGSQKYYI---NTTTGDI-PVTVKLPSDLNCIHCVLRWTYTAGNNWGVCEDGTGAM 195
            |::|||..:...:..|:   :....|| ...|:||..:.|..|||:|||...|.||.|.:||.|:
  Fly   148 FDRYPLLISGSREHRYLIPRDAKKKDIFRYKVRLPPYVTCTQCVLQWTYYTANMWGTCANGTEAV 212

  Fly   196 GCGAQETFINCADISVLSS 214
            |||..|||.||||::::|:
  Fly   213 GCGKAETFRNCADVAIVSN 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4367NP_001287421.2 LPMO_10 24..209 CDD:335201 76/192 (40%)
CG42749NP_001188545.1 Chitin_bind_3 35..226 CDD:281112 76/192 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447017
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1283095at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21113
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.