DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5023 and AT1G09170

DIOPT Version :10

Sequence 1:NP_650867.1 Gene:CG5023 / 42400 FlyBaseID:FBgn0038774 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001322245.1 Gene:AT1G09170 / 837437 AraportID:AT1G09170 Length:1046 Species:Arabidopsis thaliana


Alignment Length:106 Identity:31/106 - (29%)
Similarity:51/106 - (48%) Gaps:20/106 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RNKEQEQEVLNWVFAVIGEKVPSGQYED----ILKDGIWLCKLANKLAPGSVKKIQERGTN---- 60
            |..|..:.|.|.:..|.|..:|:...|:    .|:.||.||.:.|::.||:|.|:.|...:    
plant    56 RRYEAARWVRNTLGVVGGRDLPADPSEEDFRIALRSGILLCNVLNRVKPGAVPKVVEAPNDPLVN 120

  Fly    61 --------FQLMENIQRFQAAVKKYGVPEEEIFQTADLFER 93
                    ||..||::.|...|::.|:|   .|:.:| ||:
plant   121 QDGAALSAFQYFENLRNFLVFVEEMGIP---TFEVSD-FEK 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5023NP_650867.1 CH_dMP20-like 4..108 CDD:409056 31/106 (29%)
Calponin 145..169 CDD:459803
AT1G09170NP_001322245.1 CH_AtKIN14-like 56..173 CDD:409052 31/106 (29%)
KISc_C_terminal 432..762 CDD:276817
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.