DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5023 and AT3G10310

DIOPT Version :10

Sequence 1:NP_650867.1 Gene:CG5023 / 42400 FlyBaseID:FBgn0038774 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001325950.1 Gene:AT3G10310 / 820193 AraportID:AT3G10310 Length:969 Species:Arabidopsis thaliana


Alignment Length:198 Identity:44/198 - (22%)
Similarity:82/198 - (41%) Gaps:49/198 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAPRNKEQEQ----EVLNWVFAVIGE----KVPS-GQYEDILKDGIWLCKLANKLAPGSVKKIQE 56
            :|.|..|:..    :.:.|:.:|:|:    ..|| .::...|::|:.||...||:.||:|.|:.|
plant    10 LASRRAEEAAARRFQAVQWLKSVVGQLGIPNQPSEKEFISCLRNGMILCNAINKIHPGAVSKVVE 74

  Fly    57 RGT----------NFQLMENIQRFQAAVKKYGVPEEEIFQTADLFERRNIPQVTLS--------- 102
            ..:          .:|..||::.|..|::...:|.   |:.:|| |:.|:...:::         
plant    75 NYSYLNGEYQLPPAYQYFENVRNFLVALETLRLPG---FEASDL-EKDNLESGSVTKVVDCILGL 135

  Fly   103 -------LYALGRITQKH---PEY------TGPTLGPKMADKN-ERSFTEEQLRAHEGELNLQMG 150
                   |.:.|....||   |.:      ..|||......:: :.|...|:....:||.:...|
plant   136 KAYHECKLPSNGNGLYKHVKTPTFQLSATKIHPTLSASKTSRHLDMSSVRERNDCTDGESDKLKG 200

  Fly   151 FNK 153
            ..|
plant   201 IAK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5023NP_650867.1 CH_dMP20-like 4..108 CDD:409056 30/138 (22%)
Calponin 145..169 CDD:459803 2/9 (22%)
AT3G10310NP_001325950.1 CH_AtKIN14-like 24..137 CDD:409052 27/116 (23%)
Motor_domain 361..691 CDD:473979
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.