DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10887 and leo-1

DIOPT Version :9

Sequence 1:NP_650866.1 Gene:CG10887 / 42399 FlyBaseID:FBgn0038773 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_502135.1 Gene:leo-1 / 178052 WormBaseID:WBGene00007110 Length:430 Species:Caenorhabditis elegans


Alignment Length:460 Identity:115/460 - (25%)
Similarity:192/460 - (41%) Gaps:84/460 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 TSSEGN--ILKPRVNPVPLGPSSNTEYESNGKNYNIEKRLSQLRYSSDEKESDVLSYASSDSLDL 332
            :|||||  ...|........|||......:.|.....|:.:.|..|.|:.:|.......|||.|.
 Worm     2 SSSEGNSDASAPGTPVKSSTPSSRGSSPDSPKKQEPSKKRAILNESDDDDDSRPAPRQLSDSSDD 66

  Fly   333 NF---DYGDNAKNQNGNGMNGEVNGDKESQVLDIEEQRKPFEKDVAVKFQTTITTQNCGL--LKG 392
            |.   ..|:.:....|.|:.|:::|..:.   |.:.:.||.|.:...:...:.......|  |:|
 Worm    67 NIHPRGGGEKSSPGAGGGLFGDLSGSSDD---DSDREGKPKESNTRARLSDSDAESRGSLNDLQG 128

  Fly   393 ------------------------------------PSQFLKMPYFIPVESKAYVPETFQDRMTK 421
                                                |..|::||.|:.|.:..:.|:.:::....
 Worm   129 IVMANPDEIDEDEKAKEHVHDTEMVTGRVTLEYAADPPHFVRMPNFLSVATHPFDPQHYEEDEDD 193

  Fly   422 NDLK-DEQSREDFINRLKATVRWR----ENENKTKESNAKIVRWSDGSETFHVGNEVFDMMHHPV 481
            ...| |::.|.....|::.|:|||    ||..:.:|||||||:|.||:.:.::|||:|::...|:
 Worm   194 EQAKLDDEGRTRLKLRVENTLRWRVRKDENGKEIRESNAKIVKWDDGTMSLYLGNEIFEVSLVPL 258

  Fly   482 TVNQ-NHLYVRLGSFYQPQGLIQNKLTVRPMLDSNFGQSHVQALRNRATNKPQSGCVKVITNMGS 545
            ..|. .||||:..:....|.::.:::|.||  .|...|:|.:...|.|....::..|||:.::|.
 Worm   259 NSNNLPHLYVKQPTLMSAQAVLTHRMTFRP--HSTDSQTHRKVTLNMADRSRKNAQVKVMDDVGQ 321

  Fly   546 NPEHDHDRRMKEELSKLRQEGREKNRALMKNHPPKRDRHYQGSDHNVAKNAGAFEEDDGEGADCE 610
            |||.......::|...||...|...  :::|:...|...|          ||.:.:|:    |..
 Worm   322 NPEITRRENARKEEESLRAHIRRTQ--MVRNNFKVRGPRY----------AGQYSDDE----DMP 370

  Fly   611 TSSALEVTNE-PM--RSEEDTEDHMD-DDASWSSPNSQEEGKQSSSEDDLPIGGAIRKPTRLVYS 671
            |||......| |:  .|.|..:||.| ...|.|..:|.||.::...:          :..::|.|
 Worm   371 TSSRKGKKKEAPIIGASSESEDDHADTTKKSGSDSDSDEEYRKRKQQ----------QKKQIVTS 425

  Fly   672 GSDSD 676
            ..:||
 Worm   426 DEESD 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10887NP_650866.1 Leo1 396..548 CDD:281933 50/157 (32%)
leo-1NP_502135.1 Leo1 167..328 CDD:281933 52/162 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004097
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23146
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.