DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment mdlc and NAT5

DIOPT Version :9

Sequence 1:	NP_650865.1	Gene:	mdlc / 42397	FlyBaseID:	FBgn0038772	Length:	357	Species:	Drosophila melanogaster
Sequence 2:	NP_014896.3	Gene:	NAT5 / 854427	SGDID:	S000005779	Length:	176	Species:	Saccharomyces cerevisiae

Alignment Length:	50	Identity:	9/50 - (18%)
Similarity:	18/50 - (36%)	Gaps:	13/50 - (26%)

- Green bases have known domain annotations that are detailed below.

  Fly   297 RCIICSQQTNGIFNPAK-------------ELIARLKTNPMENSDSDEEE 333
            :|..|.|....::.||.             |.:.....|.::..:.||::
Yeast   118 KCSECHQHNVFVYLPAVDDLTKQWFIAHGFEQVGETVNNFIKGVNGDEQD 167

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
mdlc	NP_650865.1	COG5152	<181..320	CDD:227481	6/35 (17%)
		zf-CCCH	195..221	CDD:279036
		zf-RING_5	263..303	CDD:291308	2/5 (40%)
NAT5	NP_014896.3	Acetyltransf_1	<63..147	CDD:395465	5/28 (18%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R2079
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.030