DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mdlc and AT4G01023

DIOPT Version :10

Sequence 1:NP_650865.1 Gene:mdlc / 42397 FlyBaseID:FBgn0038772 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001328916.1 Gene:AT4G01023 / 826450 AraportID:AT4G01023 Length:255 Species:Arabidopsis thaliana


Alignment Length:138 Identity:41/138 - (29%)
Similarity:66/138 - (47%) Gaps:35/138 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 DVDSDGDDTKYEI---------------------HSDEETLPFKCHICRQSFVNPVVTKCKHYFC 284
            |.||:.:.::.|.                     ..|::.||..|.||:..|::||||.|.||||
plant    61 DEDSNNESSRLEKLEKKIKKETARKLETDFVLTGEEDDDALPLACSICQNPFLDPVVTNCNHYFC 125

  Fly   285 EKCALAQYKKSQRCIICSQQTNGIFNPAKELIARLKTNPMENSDSDEEEEFGK---KEDKAEAGE 346
            :||||..:.::..|.:|::.|.|:|:.|.|:..|:          :||.|..:   ||..|.. |
plant   126 DKCALKHHTENDTCFVCNEPTLGLFDTAVEIKERI----------EEEREKARAMVKEVTAML-E 179

  Fly   347 EAQEISSD 354
            :|..::.|
plant   180 KASTMADD 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mdlcNP_650865.1 COG5152 <181..320 CDD:227481 32/99 (32%)
AT4G01023NP_001328916.1 RING-HC_RNF113A_B 98..150 CDD:438201 23/51 (45%)
Tar <169..235 CDD:440602 6/20 (30%)

Return to query results.
Submit another query.