DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mdlc and NAA50

DIOPT Version :9

Sequence 1:NP_650865.1 Gene:mdlc / 42397 FlyBaseID:FBgn0038772 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_079422.1 Gene:NAA50 / 80218 HGNCID:29533 Length:169 Species:Homo sapiens


Alignment Length:105 Identity:20/105 - (19%)
Similarity:36/105 - (34%) Gaps:29/105 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 KLGIAYKSKREALPSGPQDQGATSINEMDTELDRDAQAIHARALKINEELEGKADDKIYRG---- 153
            :|||..|.....|          :|.|.|...|.         :.::.::..::....||.    
Human    85 RLGIGTKMLNHVL----------NICEKDGTFDN---------IYLHVQISNESAIDFYRKFGFE 130

  Fly   154 -INNYAQYYKKQDTAAGNASSGMVRSGPIRAPAHLRATVR 192
             |.....|||:.:.|..:     |....::.|:...|.|:
Human   131 IIETKKNYYKRIEPADAH-----VLQKNLKVPSGQNADVQ 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mdlcNP_650865.1 COG5152 <181..320 CDD:227481 3/12 (25%)
zf-CCCH 195..221 CDD:279036
zf-RING_5 263..303 CDD:291308
NAA50NP_079422.1 RimI 10..145 CDD:223532 15/78 (19%)
Acetyl-CoA binding. /evidence=ECO:0000269|PubMed:21900231, ECO:0000269|PubMed:27484799, ECO:0000269|Ref.18, ECO:0007744|PDB:2PSW, ECO:0007744|PDB:3TFY, ECO:0007744|PDB:4X5K 77..90 3/4 (75%)
Coenzyme A binding. /evidence=ECO:0000269|PubMed:21900231, ECO:0000269|PubMed:27484799, ECO:0000269|Ref.18, ECO:0007744|PDB:2PSW, ECO:0007744|PDB:3TFY, ECO:0007744|PDB:4X5K 117..126 1/8 (13%)
Substrate binding. /evidence=ECO:0000269|PubMed:21900231, ECO:0000269|PubMed:27484799, ECO:0007744|PDB:3TFY, ECO:0007744|PDB:4X5K 138..141 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2079
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.