DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mdlc and naa50

DIOPT Version :9

Sequence 1:NP_650865.1 Gene:mdlc / 42397 FlyBaseID:FBgn0038772 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_588274.1 Gene:naa50 / 2539534 PomBaseID:SPCC663.13c Length:144 Species:Schizosaccharomyces pombe


Alignment Length:89 Identity:27/89 - (30%)
Similarity:34/89 - (38%) Gaps:32/89 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 ELDRDAQAIHARALKINEELEGKA-DDKIYRGINNYAQYYKKQDTAAGNASSGMVRSGPIRAPAH 186
            |||    ||:...|||.|.:..|. |.:|   |.....:||  ||         :..||:...|:
pombe     3 ELD----AINPNNLKILEVINEKCFDPEI---IIFPTSFYK--DT---------ISVGPLAQYAY 49

  Fly   187 LR----ATVRWDYQPDICKDYKET 206
            ..    ..||       ||  |||
pombe    50 FNQVCVGAVR-------CK--KET 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mdlcNP_650865.1 COG5152 <181..320 CDD:227481 8/30 (27%)
zf-CCCH 195..221 CDD:279036 5/12 (42%)
zf-RING_5 263..303 CDD:291308
naa50NP_588274.1 RimI 1..>106 CDD:223532 27/89 (30%)
NAT_SF 48..109 CDD:173926 8/26 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2079
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.