DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Regnase-1 and N4BP1

DIOPT Version :9

Sequence 1:NP_650863.3 Gene:Regnase-1 / 42394 FlyBaseID:FBgn0038769 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_694574.3 Gene:N4BP1 / 9683 HGNCID:29850 Length:896 Species:Homo sapiens


Alignment Length:598 Identity:158/598 - (26%)
Similarity:229/598 - (38%) Gaps:205/598 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EQHKQQQQQQQVHQ----QQQKHGSSN-------KLPVRKQES---------CSDDDESQ--SPS 53
            :.|.||...::..|    .:.|..:||       .:|:.::..         |:.|.|:.  |||
Human   431 QAHTQQNMVEKFSQLPFKVEAKPCTSNCRINTFRTVPIEQKHEVWGSNQNYICNTDPETDGLSPS 495

  Fly    54 -RTTERQNLEFAKKLGYSEQSIHSALTRLGSEAKQNELLAELIKLTADAPRPAHIGGGGSPSSM- 116
             .:...:.:.|..:...|.|.........|...:...||...:|...:    ..:|...||.|. 
Human   496 VASPSPKEVNFVSRGASSHQPRVPLFPENGLHQQPEPLLPNNMKSACE----KRLGCCSSPHSKP 556

  Fly   117 -TSTLSSP--------------------------TGG---------------SNSSG---LRHIV 136
             .||||.|                          ||.               .|..|   |:|||
Human   557 NCSTLSPPMPLPQLLPSVTDARSAGPSDHIDSSVTGVQRFRDTLKIPYKLELKNEPGRTDLKHIV 621

  Fly   137 IDGSNVALSHGNNLVFSCRGIRICVDWFRQRGHRDITAFVPNWRKEMANNNIADQELLYELEHER 201
            |||||||::||....||||||.|.|::|.:.|:|:||.|||.||.. .:.|:.:|..|.:|:...
Human   622 IDGSNVAITHGLKKFFSCRGIAIAVEYFWKLGNRNITVFVPQWRTR-RDPNVTEQHFLTQLQELG 685

  Fly   202 YLVFTPSRHLDGKRVSCYDDRFILKLAVETDGIVVSNDNYRDLILESNEFRRVVQERLLMYSFVN 266
            .|..||:|.:.|:|::.:||||:|.||.:|.||:|:|||:|:.:.||..:|.::.:|||.|:||.
Human   686 ILSLTPARMVFGERIASHDDRFLLHLADKTGGIIVTNDNFREFVNESVSWREIITKRLLQYTFVG 750

  Fly   267 DIFMPPDDPLGRSGPNLDLFLCSQTQQKMADAQQLCPYGKKCTYGQKCKFRHHNQAPLLQRLP-- 329
            ||||.||||||||||.|:.||  |.:..:.|.|                       |||..||  
Human   751 DIFMVPDDPLGRSGPRLEEFL--QKEVCLRDMQ-----------------------PLLSALPNV 790

  Fly   330 --LQASHSAPLHTNGGQQLVSPGGNNNNVKINSLISREPLGRTKSNTIEQVCQGFSAQMDLSEGA 392
              ...|...|     |.|..|             .|.:|..|.                   :||
Human   791 GMFDPSFRVP-----GTQAAS-------------TSHQPPTRI-------------------QGA 818

  Fly   393 VESSQPNRHKKLQRQQPPPAYRLLVPTYSAPLQQQQHQAQQQHQQSNSSTNYHHQYLTRTPSAPV 457
                 |:.|.                     |.||.|                   ....|:.|.
Human   819 -----PSSHW---------------------LPQQPH-------------------FPLLPALPS 838

  Fly   458 TDQGLGLPLPAHNFAHLSASDSRINEELHASQQLPREEQRRLLRYHLGSLFPPHQVHAVLQLYPE 522
            ..|  .||:||..      |.:..||...|..::..:.::||            ::..:|..:|.
Human   839 LQQ--NLPMPAQR------SSAETNELREALLKIFPDSEQRL------------KIDQILVAHPY 883

  Fly   523 ETDAKTICAAILN 535
            ..|...:.|.:|:
Human   884 MKDLNALSAMVLD 896

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Regnase-1NP_650863.3 RNase_Zc3h12a 131..284 CDD:288804 80/155 (52%)
N4BP1NP_694574.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 403..430
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 488..507 4/18 (22%)
RNase_Zc3h12a 616..769 CDD:288804 80/153 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 801..821 9/56 (16%)
CoCUN. /evidence=ECO:0000305|PubMed:31319543 849..896 10/64 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157332
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3777
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D335949at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12876
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.