DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Regnase-1 and NYNRIN

DIOPT Version :9

Sequence 1:NP_650863.3 Gene:Regnase-1 / 42394 FlyBaseID:FBgn0038769 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_079357.2 Gene:NYNRIN / 57523 HGNCID:20165 Length:1898 Species:Homo sapiens


Alignment Length:247 Identity:91/247 - (36%)
Similarity:140/247 - (56%) Gaps:13/247 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 SPSRTTERQNLEFAKKLGYSEQSIHSALTRLGSEAKQNELLAELIKLTADAPR--PAHIGGGGSP 113
            |..:.|.|.::...|..|.:.:....:...|...:|....:..|:.....|||  |.|:....:.
Human   701 SEVQPTSRASVSLLKGQGQAGRQGPQSSGTLALSSKHQFQMEGLLGAWEGAPRQPPRHLQANSTV 765

  Fly   114 SSMT---STLSSP-----TGGSNSSGLRHIVIDGSNVALSHGNNLVFSCRGIRICVDWFRQRGHR 170
            :|..   ..|::|     :|...:.|||.:|||||:||:.||....||||||.:.|.:|..||||
Human   766 TSFQRYHEALNTPFELNLSGEPGNQGLRRVVIDGSSVAMVHGLQHFFSCRGIAMAVQFFWNRGHR 830

  Fly   171 DITAFVPNWRKEMANNNIADQELLYELEHERYLVFTPSRHLDGKRVSCYDDRFILKLAVETDGIV 235
            ::|.|||.|:.: .|..:.:...|.:|...:.|..|||:..:||:::.||.||::|||.|||||:
Human   831 EVTVFVPTWQLK-KNRRVRESHFLTKLHSLKMLSITPSQLENGKKITTYDYRFMVKLAEETDGII 894

  Fly   236 VSNDNYRDLILESNEFRRVVQERLLMYSFVNDIFMPPDDPLGRSGPNLDLFL 287
            |:|:...  ||.::..:.:|::|||.::|..::||.|||||||.||.||.||
Human   895 VTNEQIH--ILMNSSKKLMVKDRLLPFTFAGNLFMVPDDPLGRDGPTLDEFL 944

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Regnase-1NP_650863.3 RNase_Zc3h12a 131..284 CDD:288804 70/152 (46%)
NYNRINNP_079357.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..315
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 424..450
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 467..533
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 618..691
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 711..731 2/19 (11%)
RNase_Zc3h12a 791..942 CDD:288804 71/153 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 968..1019
RNase_H_like 1161..1264 CDD:301345
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157326
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D335949at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12876
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.