DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Regnase-1 and CG42360

DIOPT Version :9

Sequence 1:NP_650863.3 Gene:Regnase-1 / 42394 FlyBaseID:FBgn0038769 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_611946.2 Gene:CG42360 / 37937 FlyBaseID:FBgn0259742 Length:496 Species:Drosophila melanogaster


Alignment Length:258 Identity:94/258 - (36%)
Similarity:134/258 - (51%) Gaps:50/258 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PVRKQESCSDDDESQSPSRTTERQNLEF-----AKKLG-YSEQSIHSALTRLGSEAKQNELLAEL 94
            |.|:.|.......:::|::.|.|.|..|     .|||| |:..:.:                   
  Fly   281 PFREGEKQRRARPAKTPNKKTARMNDSFFTTEEKKKLGDYNTNTFN------------------- 326

  Fly    95 IKLTADAPRPAHIGGGGSPSSMTSTLSSPTGGSNSSGLRHIVIDGSNVALSHGNNLVFSCRGIRI 159
                     |....|..|....|:.             |.::|||||||.:|||:.|||..||:.
  Fly   327 ---------PTEEAGEASNKPKTNK-------------RFVIIDGSNVAFAHGNSNVFSSEGIKY 369

  Fly   160 CVDWFRQRGHRDITAFVPNWRKEMANNNIADQELLYELEHERYLVFTPSRHLDGKRVSCYDDRFI 224
            |:.:|.:.|| ::.|.||.:||.  |...::.|||.:|..|..:||||.:::.|:..|.||||||
  Fly   370 CLQYFEKMGH-EVKAVVPMFRKN--NFKSSNPELLDKLHKEGKIVFTPCKNIPGQITSSYDDRFI 431

  Fly   225 LKLAVETDGIVVSNDNYRDLILESNEFRRVVQERLLMYSFVNDIFMPPDDPLGRSGPNLDLFL 287
            |:||.|.:..|||||||||||.|:..|:.:|:.|:|.||:.::||:.|.||.||.||.||..|
  Fly   432 LQLAYEKNAAVVSNDNYRDLINENPAFKLIVENRVLGYSWCDNIFILPKDPYGRWGPTLDEIL 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Regnase-1NP_650863.3 RNase_Zc3h12a 131..284 CDD:288804 74/152 (49%)
CG42360NP_611946.2 RNase_Zc3h12a 341..492 CDD:288804 75/166 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469332
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3777
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D335949at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.