DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Regnase-1 and CG42360

DIOPT Version :10

Sequence 1:NP_650863.3 Gene:Regnase-1 / 42394 FlyBaseID:FBgn0038769 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_611946.2 Gene:CG42360 / 37937 FlyBaseID:FBgn0259742 Length:496 Species:Drosophila melanogaster


Alignment Length:258 Identity:94/258 - (36%)
Similarity:134/258 - (51%) Gaps:50/258 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PVRKQESCSDDDESQSPSRTTERQNLEF-----AKKLG-YSEQSIHSALTRLGSEAKQNELLAEL 94
            |.|:.|.......:::|::.|.|.|..|     .|||| |:..:.:                   
  Fly   281 PFREGEKQRRARPAKTPNKKTARMNDSFFTTEEKKKLGDYNTNTFN------------------- 326

  Fly    95 IKLTADAPRPAHIGGGGSPSSMTSTLSSPTGGSNSSGLRHIVIDGSNVALSHGNNLVFSCRGIRI 159
                     |....|..|....|:.             |.::|||||||.:|||:.|||..||:.
  Fly   327 ---------PTEEAGEASNKPKTNK-------------RFVIIDGSNVAFAHGNSNVFSSEGIKY 369

  Fly   160 CVDWFRQRGHRDITAFVPNWRKEMANNNIADQELLYELEHERYLVFTPSRHLDGKRVSCYDDRFI 224
            |:.:|.:.|| ::.|.||.:||.  |...::.|||.:|..|..:||||.:::.|:..|.||||||
  Fly   370 CLQYFEKMGH-EVKAVVPMFRKN--NFKSSNPELLDKLHKEGKIVFTPCKNIPGQITSSYDDRFI 431

  Fly   225 LKLAVETDGIVVSNDNYRDLILESNEFRRVVQERLLMYSFVNDIFMPPDDPLGRSGPNLDLFL 287
            |:||.|.:..|||||||||||.|:..|:.:|:.|:|.||:.::||:.|.||.||.||.||..|
  Fly   432 LQLAYEKNAAVVSNDNYRDLINENPAFKLIVENRVLGYSWCDNIFILPKDPYGRWGPTLDEIL 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Regnase-1NP_650863.3 UBA_6 61..97 CDD:407876 6/41 (15%)
PIN_Zc3h12-like 135..263 CDD:350296 62/127 (49%)
Regnase_1_C 495..534 CDD:465803
CG42360NP_611946.2 PIN_Zc3h12a-N4BP1-like 345..469 CDD:350286 62/126 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.