DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Regnase-1 and Ccdc59

DIOPT Version :9

Sequence 1:NP_650863.3 Gene:Regnase-1 / 42394 FlyBaseID:FBgn0038769 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001101560.1 Gene:Ccdc59 / 314799 RGDID:1311912 Length:240 Species:Rattus norvegicus


Alignment Length:113 Identity:23/113 - (20%)
Similarity:39/113 - (34%) Gaps:23/113 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   402 KKLQRQQPPPAYRLLVPTYSAPLQQQQHQAQQQHQQSNSSTNYHHQYLTRTPSAPVTDQGLGLPL 466
            ::|::||......|.......||.:::...:|...:..||. :..|     |..|.|...:..|.
  Rat   102 ERLRKQQRKVDLALSEGQLDQPLPEEEGNTEQAVSEEQSSV-FQPQ-----PEEPSTVNSVTFPK 160

  Fly   467 PAHNFAHLSASDSRINEELHASQ-------------QLPREEQRRLLR 501
            ....    ..|:.:..||....|             :..|||.:||.:
  Rat   161 KKRK----KTSNQKAQEEYERVQAKRAAKKFEFEMRKQEREEAQRLYK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Regnase-1NP_650863.3 RNase_Zc3h12a 131..284 CDD:288804
Ccdc59NP_001101560.1 60KD_IMP <164..>211 CDD:294333 9/45 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3777
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.