Sequence 1: | NP_650863.3 | Gene: | Regnase-1 / 42394 | FlyBaseID: | FBgn0038769 | Length: | 540 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_054886.2 | Gene: | CCDC59 / 29080 | HGNCID: | 25005 | Length: | 241 | Species: | Homo sapiens |
Alignment Length: | 209 | Identity: | 39/209 - (18%) |
---|---|---|---|
Similarity: | 64/209 - (30%) | Gaps: | 95/209 - (45%) |
- Green bases have known domain annotations that are detailed below.
Fly 343 GQQLVSPGGNNNNVKINSLISREP---LGRTKSNTIEQVCQGFSAQMDLSEGAVESSQPNRHKKL 404
Fly 405 QRQQPPPAYRLLVPTYSAPLQQQQHQAQQQHQQSNSSTNYHHQYLTRTPSAPVTDQGLGLPLPAH 469
Fly 470 NFAHLSASDSRINEELHASQQLPREEQRRLLRYHLGSLFPPHQVHAVL----------------- 517
Fly 518 --QLYPEETDAKTI 529 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Regnase-1 | NP_650863.3 | RNase_Zc3h12a | 131..284 | CDD:288804 | |
CCDC59 | NP_054886.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..22 | 1/2 (50%) | |
rRNA_processing | <160..238 | CDD:312134 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 182..205 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3777 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |