DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Regnase-1 and CCDC59

DIOPT Version :9

Sequence 1:NP_650863.3 Gene:Regnase-1 / 42394 FlyBaseID:FBgn0038769 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_054886.2 Gene:CCDC59 / 29080 HGNCID:25005 Length:241 Species:Homo sapiens


Alignment Length:209 Identity:39/209 - (18%)
Similarity:64/209 - (30%) Gaps:95/209 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 GQQLVSPGGNNNNVKINSLISREP---LGRTKSNTIEQVCQGFSAQMDLSEGAVESSQPNRHKKL 404
            |:.:.:.|..|.||:..:.....|   :|..:..      |||:.:                :||
Human    19 GEGVSTVGYRNKNVRQKTWRPNHPQAFVGSVREG------QGFAFR----------------RKL 61

  Fly   405 QRQQPPPAYRLLVPTYSAPLQQQQHQAQQQHQQSNSSTNYHHQYLTRTPSAPVTDQGLGLPLPAH 469
            :.||   :|:.|:                 .::..:.|:...|:..|.|.               
Human    62 KIQQ---SYKKLL-----------------RKEKKAQTSLESQFTDRYPD--------------- 91

  Fly   470 NFAHLSASDSRINEELHASQQLPREEQRRLLRYHLGSLFPPHQVHAVL----------------- 517
            |..||..::    ||.|       .:|.|.:.:.|.     .|||..|                 
Human    92 NLKHLYLAE----EERH-------RKQARKVDHPLS-----EQVHQPLLEEQCSIDEPLFEDQCS 140

  Fly   518 --QLYPEETDAKTI 529
              |..|||...||:
Human   141 FDQPQPEEQCIKTV 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Regnase-1NP_650863.3 RNase_Zc3h12a 131..284 CDD:288804
CCDC59NP_054886.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 1/2 (50%)
rRNA_processing <160..238 CDD:312134
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..205
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3777
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.