DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Regnase-1 and KHNYN

DIOPT Version :9

Sequence 1:NP_650863.3 Gene:Regnase-1 / 42394 FlyBaseID:FBgn0038769 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_011534892.1 Gene:KHNYN / 23351 HGNCID:20166 Length:721 Species:Homo sapiens


Alignment Length:247 Identity:106/247 - (42%)
Similarity:142/247 - (57%) Gaps:28/247 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 LRHIVIDGSNVALSHGNNLVFSCRGIRICVDWFRQRGHRDITAFVPNWRKEMANNNIADQELLYE 196
            ||||||||||||:.||....||.|||.|.|.:|..|||||||.|||.||.. .:..:.:...|.:
Human   480 LRHIVIDGSNVAMVHGLQHYFSSRGIAIAVQYFWDRGHRDITVFVPQWRFS-KDAKVRESHFLQK 543

  Fly   197 LEHERYLVFTPSRHLDGKRVSCYDDRFILKLAVETDGIVVSNDNYRDLILESNEFRRVVQERLLM 261
            |.....|..||||.:||||:|.|||||::|||.|||||:||||.:|||..||.::..:::||||.
Human   544 LYSLSLLSLTPSRVMDGKRISSYDDRFMVKLAEETDGIIVSNDQFRDLAEESEKWMAIIRERLLP 608

  Fly   262 YSFVNDIFMPPDDPLGRSGPNLDLFLCSQTQ-QKMADAQQ----LCPYGKKCTYGQKCK----FR 317
            ::||.::||.|||||||:||.||.||....: |..:.||.    ...:||:....::.|    .|
Human   609 FTFVGNLFMVPDDPLGRNGPTLDEFLKKPARTQGSSKAQHPSRGFAEHGKQQQGREEEKGSGGIR 673

  Fly   318 HHNQAPLLQRLPLQASHSAPLHTNGGQQLVSPGGNNNNVKINSLISREPLGR 369
            ...:...|:|..|:..        .||          :.|::.::.|||..|
Human   674 KTRETERLRRQLLEVF--------WGQ----------DHKVDFILQREPYCR 707

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Regnase-1NP_650863.3 RNase_Zc3h12a 131..284 CDD:288804 85/151 (56%)
KHNYNXP_011534892.1 RNase_Zc3h12a 479..632 CDD:288804 86/152 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157334
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D335949at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12876
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.