DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Regnase-1 and C29F5.3

DIOPT Version :9

Sequence 1:NP_650863.3 Gene:Regnase-1 / 42394 FlyBaseID:FBgn0038769 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_495262.2 Gene:C29F5.3 / 183011 WormBaseID:WBGene00016212 Length:363 Species:Caenorhabditis elegans


Alignment Length:182 Identity:52/182 - (28%)
Similarity:81/182 - (44%) Gaps:22/182 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 RHIVIDGSNV-------ALSHGNNLVFSCRGIRICVDWFRQRGHRDITAFVPNWRKEMANNNIAD 190
            |.:||||.|:       |.:|     ..|.|:...|.|...| ..|:|.|:|.....:.|.|..:
 Worm    23 RPLVIDGCNIGRSASGYARTH-----VDCAGLVSVVRWLLIR-RFDVTVFLPVVYNNVNNYNSKN 81

  Fly   191 QELLYELEHERYLVFTPSRHLDGKRVSC--YDDRFILKLAVETDGIVVSNDNYRDLILES--NEF 251
            .|||.:||....:.|||:|...|.|.:.  |||.:::..|....|.:||.|.::|::.:.  ::|
 Worm    82 AELLAKLEQLGIVTFTPARSGRGLRKAFINYDDLYVVSYAARHGGTIVSGDKFKDILNQPCYSDF 146

  Fly   252 RRVVQERLLMYSF---VNDIFMPPDDPLGRSGPNLDLFLCSQTQQKMADAQQ 300
            ..|::.|.:...|   ..|......|...|..|  :||....|.|:....:|
 Worm   147 HHVIRNRTVDVKFRPLTLDFVEYQSDRFYRHAP--ELFTYENTSQRTESLRQ 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Regnase-1NP_650863.3 RNase_Zc3h12a 131..284 CDD:288804 47/164 (29%)
C29F5.3NP_495262.2 PIN_SF 25..157 CDD:391943 41/137 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12876
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.