DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Regnase-1 and rde-8

DIOPT Version :9

Sequence 1:NP_650863.3 Gene:Regnase-1 / 42394 FlyBaseID:FBgn0038769 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_501107.1 Gene:rde-8 / 177483 WormBaseID:WBGene00022620 Length:339 Species:Caenorhabditis elegans


Alignment Length:221 Identity:53/221 - (23%)
Similarity:79/221 - (35%) Gaps:66/221 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 EQSIHSALT-RLGSEAKQNELL----------AELIKLTADAPRPAHIGGGGSPSSMTSTLSSPT 124
            |:...:.|| ||..|..:|:.|          :.:|||.:..|                      
 Worm    24 EKFCSNRLTERLKCERMRNQYLQACPEGKDQFSSVIKLYSVIP---------------------- 66

  Fly   125 GGSNSSGLRHIVIDGSNV--------------ALSHGNNLVFSCRGIRICVDWFRQRGHRDITAF 175
                :|..|.|||||:||              ..||..:::.....||..|       .||...|
 Worm    67 ----NSVARTIVIDGANVMHCGSGYPDRRENSKSSHIPDVMPLLSLIRFFV-------VRDFEVF 120

  Fly   176 VPNWRKEMANNNIADQELLYELEHERYLVFTPSRHLDGKRVSCYDDRFILKLAVETDGIVVSNDN 240
            |...||....:....:..:..|......|..||.:|        ||...|:.|.:.:|:|::.|.
 Worm   121 VVISRKYAKQDATNFKSAIDRLIENHLCVVVPSSNL--------DDSVALQFASQINGVVITTDQ 177

  Fly   241 YRDLILESNEFRRVVQERLLMYSFVN 266
            |||...:|..|..:|:|..|...:.|
 Worm   178 YRDHASDSLRFNTIVRENRLGIKWEN 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Regnase-1NP_650863.3 RNase_Zc3h12a 131..284 CDD:288804 40/150 (27%)
rde-8NP_501107.1 RNase_Zc3h12a 69..216 CDD:371828 40/150 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12876
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.