DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Regnase-1 and khnyn

DIOPT Version :9

Sequence 1:NP_650863.3 Gene:Regnase-1 / 42394 FlyBaseID:FBgn0038769 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_002934330.2 Gene:khnyn / 100497056 XenbaseID:XB-GENE-1219052 Length:841 Species:Xenopus tropicalis


Alignment Length:256 Identity:105/256 - (41%)
Similarity:152/256 - (59%) Gaps:27/256 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 NSSG---LRHIVIDGSNVALSHGNNLVFSCRGIRICVDWFRQRGHRDITAFVPNWRKEMANNNIA 189
            |..|   ||:|:|||||||:.||.:..||||||.:.|.:|..||||.||.|||.||.: .::.:.
 Frog   579 NEKGNEELRYIIIDGSNVAMIHGLHRFFSCRGIALAVQYFWDRGHRGITVFVPQWRMK-KDSKVK 642

  Fly   190 DQELLYELEHERYLVFTPSRHLDGKRVSCYDDRFILKLAVETDGIVVSNDNYRDLILESNEFRRV 254
            :|..|.||.....|.|||||.::||||:.|||||:|:||.:|||::|:|||.||:..||..::.:
 Frog   643 EQHFLTELNDLGLLSFTPSRTIEGKRVTSYDDRFMLQLAEKTDGVIVTNDNLRDIAAESQAWKTI 707

  Fly   255 VQERLLMYSFVNDIFMPPDDPLGRSGPNLDLFLCS----QTQQK---MADAQQLCPYGKKCTYGQ 312
            :::|||.|:||.||||.|||||||:||.|:.||..    :|:.|   .|..:......||.:..:
 Frog   708 IKDRLLQYTFVGDIFMVPDDPLGRNGPPLNQFLSKNLRPRTKSKGHSFAGRRGTHSAPKKSSQTE 772

  Fly   313 KCKFRHHNQAPLLQRLPLQASHSAPLHT-NGGQQL------VSPGGNNNNVKINSLISREP 366
            ...||......:|:      ...|.:.: |..|:|      :.|   :.:.|::.::.|||
 Frog   773 VLNFRDRKAGAVLE------ERKADVRSFNETQRLRHELLNIFP---SQDSKVDYILHREP 824

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Regnase-1NP_650863.3 RNase_Zc3h12a 131..284 CDD:288804 84/155 (54%)
khnynXP_002934330.2 KH-I 18..88 CDD:412160
KH-I 90..155 CDD:412160
RNase_Zc3h12a 585..738 CDD:403256 84/153 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D335949at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12876
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.