DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and ZNF251

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_612376.1 Gene:ZNF251 / 90987 HGNCID:13045 Length:671 Species:Homo sapiens


Alignment Length:468 Identity:118/468 - (25%)
Similarity:197/468 - (42%) Gaps:107/468 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 FRETCQRSYGHLRQFVGPV-------EVEQ------------RPPE-----KKGSETATKLEPDV 122
            :|:....:||::.....||       ::||            ..|:     :|.||..||.|..:
Human    40 YRDVMLENYGNVASLGFPVPKPELISQLEQGKELWVLNLLGAEEPDILKSCQKDSEVGTKKELSI 104

  Fly   123 DPDEAEQEPEHDE-EDEDVDLDESHYAEADDAAETQGGVFHDEIEDGILVELEKDRIVHVKNEQV 186
            ...:..:|.:..| ....:..|.:..||..:|...:|.:              |:|:.:...:.:
Human   105 LNQKFSEEVKTPEFVSRRLLRDNAQAAEFREAWGREGKL--------------KERVGNSAGQSL 155

  Fly   187 EEDGIIEEVYDVYETYEGDLIPDQGYDHEMADQALSELSAEIEYLDQ-VEHDQLTESAHEDDAEV 250
            .:..|.:.|  :.|...|            .:::|.|.:.|....|: :..||       :...:
Human   156 NKPNIHKRV--LTEATVG------------RERSLGERTQECSAFDRNLNLDQ-------NVVRL 199

  Fly   251 DLNSTEEEF----VPSKSVR----ASIHARNATKRRVNP------RRSATSTASVAVESSTSKTT 301
            ..|.|.|..    :.||:.:    .|.|.|:.|..:  |      .|:.|.::::.:..      
Human   200 QRNKTGERVFKCDICSKTFKYNSDLSRHQRSHTGEK--PYECGRCGRAFTHSSNLVLHH------ 256

  Fly   302 DRGNPLKVRRGNS----DSAGSKMSIKS-----------EKDISIGEVLARKHSGIKTKGGHKIL 351
                  .:..||.    |..|....:.|           ||....|| ..:..|...|...|:|:
Human   257 ------HIHTGNKPFKCDECGKTFGLNSHLRLHRRIHTGEKPFGCGE-CGKAFSRSSTLIQHRII 314

  Fly   352 LGDKKEFKYICDVCGNMYPSQSRLTEHIKVHSGVKPHECEICGHCFAQAQQLARHMNTHTGNRPY 416
            ...:|.:|  |:.||..:....:||:|.::|:|.|||||..||..|:::..|.:|...|||.:|:
Human   315 HTGEKPYK--CNECGRGFSQSPQLTQHQRIHTGEKPHECSHCGKAFSRSSSLIQHERIHTGEKPH 377

  Fly   417 KCSYCPAAFADLSTRNKHHRIHTNERPYECDVCHKTFTYTNTLKFHKMIHTGEKPHVCDVCGKGF 481
            ||:.|..||:..|:...|||:||.|:||.|:.|.:.|.:.:.|..|..|||||||:||:.|||.|
Human   378 KCNQCGKAFSQSSSLFLHHRVHTGEKPYVCNECGRAFGFNSHLTEHVRIHTGEKPYVCNECGKAF 442

  Fly   482 PQAYKLRNHRVIH 494
            .::..|..||.:|
Human   443 RRSSTLVQHRRVH 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 3/12 (25%)
C2H2 Zn finger 362..382 CDD:275368 6/19 (32%)
zf-H2C2_2 375..399 CDD:290200 13/23 (57%)
COG5048 386..>447 CDD:227381 28/60 (47%)
C2H2 Zn finger 390..410 CDD:275368 6/19 (32%)
zf-H2C2_2 403..426 CDD:290200 10/22 (45%)
C2H2 Zn finger 418..438 CDD:275368 8/19 (42%)
zf-H2C2_2 432..455 CDD:290200 11/22 (50%)
C2H2 Zn finger 446..466 CDD:275368 5/19 (26%)
zf-H2C2_2 459..481 CDD:290200 14/21 (67%)
C2H2 Zn finger 474..494 CDD:275368 8/19 (42%)
ZNF251NP_612376.1 KRAB 15..75 CDD:214630 7/34 (21%)
C2H2 Zn finger 181..203 CDD:275368 4/28 (14%)
COG5048 207..635 CDD:227381 82/266 (31%)
C2H2 Zn finger 211..231 CDD:275368 5/19 (26%)
C2H2 Zn finger 239..259 CDD:275368 2/31 (6%)
C2H2 Zn finger 267..287 CDD:275368 3/19 (16%)
C2H2 Zn finger 295..315 CDD:275368 6/20 (30%)
C2H2 Zn finger 323..343 CDD:275368 6/19 (32%)
C2H2 Zn finger 351..371 CDD:275368 6/19 (32%)
C2H2 Zn finger 379..399 CDD:275368 8/19 (42%)
C2H2 Zn finger 407..427 CDD:275368 5/19 (26%)
C2H2 Zn finger 435..455 CDD:275368 8/19 (42%)
C2H2 Zn finger 463..483 CDD:275368
C2H2 Zn finger 491..511 CDD:275368
C2H2 Zn finger 568..588 CDD:275368
C2H2 Zn finger 596..616 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.