DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and ZNF528

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:XP_006723481.1 Gene:ZNF528 / 84436 HGNCID:29384 Length:712 Species:Homo sapiens


Alignment Length:297 Identity:80/297 - (26%)
Similarity:131/297 - (44%) Gaps:64/297 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 YDHEMADQA----LSELSAEI------EYLDQVEHDQLTESAHEDDAEVDLNSTEEEFVPSKSVR 266
            ::..::|.:    |.::|:.:      :|.:..:|..|            |...::..:..|:.:
Human   219 FEKPVSDNSSVSPLEKISSSVKSHLLNKYRNNFDHAPL------------LPQEQKAHIREKAYK 271

  Fly   267 ASIHARNATKRRVNPRRSATSTASVAVESSTSKTTDRGNPLKVRR-GNSDSAGSKMSIKSEKDIS 330
            .:.|.:             ...||.::.:......|  ||.|... |...|..||:.|.      
Human   272 CNEHGQ-------------VFRASASLTNQVIHNAD--NPYKCSECGKVFSCSSKLVIH------ 315

  Fly   331 IGEVLARKHSGIKTKGGHKILLGDKKEFKYICDVCGNMYPSQSRLTEHIKVHSGVKPHECEICGH 395
                 .|.|:|               |..|.|..||.::.|.|.|::|.::|:|.||::|..|..
Human   316 -----RRMHTG---------------EKPYKCHECGKLFSSNSNLSQHQRIHTGEKPYKCHECDK 360

  Fly   396 CFAQAQQLARHMNTHTGNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCHKTFTYTNTLK 460
            .|..:.:||:|...|||.:||||..|...|..::...:|.:|||.|:||.|:.|.|.|:..:.|.
Human   361 VFRSSSKLAQHQRIHTGEKPYKCHECDKVFNQIAHLVRHQKIHTGEKPYSCNKCGKVFSRHSYLA 425

  Fly   461 FHKMIHTGEKPHVCDVCGKGFPQAYKLRNHRVIHERR 497
            .|:.:||||||:.|:.|||.|.....|..|::||..|
Human   426 EHQTVHTGEKPYKCEECGKAFSVRSSLITHQLIHTGR 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871
C2H2 Zn finger 362..382 CDD:275368 7/19 (37%)
zf-H2C2_2 375..399 CDD:290200 9/23 (39%)
COG5048 386..>447 CDD:227381 24/60 (40%)
C2H2 Zn finger 390..410 CDD:275368 6/19 (32%)
zf-H2C2_2 403..426 CDD:290200 11/22 (50%)
C2H2 Zn finger 418..438 CDD:275368 4/19 (21%)
zf-H2C2_2 432..455 CDD:290200 11/22 (50%)
C2H2 Zn finger 446..466 CDD:275368 6/19 (32%)
zf-H2C2_2 459..481 CDD:290200 12/21 (57%)
C2H2 Zn finger 474..494 CDD:275368 7/19 (37%)
ZNF528XP_006723481.1 KRAB 8..68 CDD:214630
KRAB 8..47 CDD:279668
C2H2 Zn finger 272..291 CDD:275368 3/31 (10%)
COG5048 277..712 CDD:227381 71/227 (31%)
C2H2 Zn finger 299..319 CDD:275368 6/30 (20%)
zf-H2C2_2 312..336 CDD:290200 9/49 (18%)
C2H2 Zn finger 327..347 CDD:275368 7/19 (37%)
zf-H2C2_2 339..364 CDD:290200 9/24 (38%)
C2H2 Zn finger 355..375 CDD:275368 6/19 (32%)
zf-H2C2_2 368..392 CDD:290200 12/23 (52%)
C2H2 Zn finger 383..403 CDD:275368 4/19 (21%)
zf-H2C2_2 395..420 CDD:290200 11/24 (46%)
C2H2 Zn finger 411..431 CDD:275368 6/19 (32%)
zf-H2C2_2 423..447 CDD:290200 12/23 (52%)
C2H2 Zn finger 439..459 CDD:275368 7/19 (37%)
C2H2 Zn finger 467..487 CDD:275368
C2H2 Zn finger 495..515 CDD:275368
C2H2 Zn finger 523..543 CDD:275368
zf-H2C2_2 535..560 CDD:290200
C2H2 Zn finger 551..571 CDD:275368
zf-H2C2_2 563..588 CDD:290200
C2H2 Zn finger 579..599 CDD:275368
zf-H2C2_2 591..616 CDD:290200
C2H2 Zn finger 607..627 CDD:275368
zf-H2C2_2 619..642 CDD:290200
C2H2 Zn finger 635..655 CDD:275368
C2H2 Zn finger 663..683 CDD:275368
zf-H2C2_2 675..700 CDD:290200
C2H2 Zn finger 691..711 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.