DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and ZNF394

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_115540.2 Gene:ZNF394 / 84124 HGNCID:18832 Length:561 Species:Homo sapiens


Alignment Length:564 Identity:135/564 - (23%)
Similarity:198/564 - (35%) Gaps:162/564 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 TCQR--SYGHLRQFVGPVEVEQRPPEKKGSETATKLEPDVDPDEAEQEPEHDEEDEDVDLDESHY 147
            |.||  |...|..:|.....:...|.::......|:|.|   .....||.:.....|.:....|:
Human     6 TAQRRGSDAELGPWVMAARSKDAAPSQRDGLLPVKVEED---SPGSWEPNYPAASPDPETSRLHF 67

  Fly   148 AEADDAAETQGGVFHDEI---EDGI--LVELEKD--RIVHVKNEQVEEDGIIEEVYDV----YET 201
            .:          :.:.|:   |:.:  |.||.:.  |...:..||:.|..::|:...:    .:.
Human    68 RQ----------LRYQEVAGPEEALSRLRELCRRWLRPELLSKEQILELLVLEQFLTILPEELQA 122

  Fly   202 YEGDLIPDQGYDH--------------------EMADQALSELSAEIEYLDQVEHDQLTESAHED 246
            :..:..|:.|.:.                    ...|.|:|....|.|.||....|...|||.:|
Human   123 WVREHCPESGEEAVAVVRALQRALDGTSSQGMVTFEDTAVSLTWEEWERLDPARRDFCRESAQKD 187

  Fly   247 DAEVDLNSTE-----EEFVPSKSVRASIHARNATKRRVNPRRSATSTASVAVESSTSKTTDRGNP 306
            .......|.|     :|.:|.:.:......:...:.....:|...|......|....|.:  |:|
Human   188 SGSTVPPSLESRVENKELIPMQQILEEAEPQGQLQEAFQGKRPLFSKCGSTHEDRVEKQS--GDP 250

  Fly   307 LKVRRGNSDSAGSKMSIKS-EKDISI-GE----------------VLAR-----------KHSGI 342
            |.::..||..|....||.. .|:.|| ||                ||.:           :..|.
Human   251 LPLKLENSPEAEGLNSISDVNKNGSIEGEDSKNNELQNSARCSNLVLCQHIPKAERPTDSEEHGN 315

  Fly   343 KTKGG-----------HKILLGDK--------------KEFKYICDVCGNMYPSQSRLTEHIKVH 382
            |.|..           ||...||.              :|..|.|..||..:..:|.|..|.::|
Human   316 KCKQSFHMVTWHVLKPHKSDSGDSFHHSSLFETQRQLHEERPYKCGNCGKSFKQRSDLFRHQRIH 380

  Fly   383 SGVKPHECEICGHCFAQAQQLARHMNTHT------------------------------------ 411
            :|.||:.|:.||..|:|:..|.:|..|||                                    
Human   381 TGEKPYGCQECGKSFSQSAALTKHQRTHTGEKPYTCLKCGERFRQNSHLNRHQSTHSRDKHFKCE 445

  Fly   412 -------------------GNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCHKTFTYTN 457
                               |.|||||..|..:|...|...|||||||.|:||.|.||.|.|..:.
Human   446 ECGETCHISNLFRHQRLHKGERPYKCEECEKSFKQRSDLFKHHRIHTGEKPYGCSVCGKRFNQSA 510

  Fly   458 TLKFHKMIHTGEKPHVCDVCGKGFPQAYKLRNHRVIHERRGQSA 501
            ||..|:.|||||||:.|..||:.|.|:..|..|:.||:.:..||
Human   511 TLIKHQRIHTGEKPYKCLECGERFRQSTHLIRHQRIHQNKVLSA 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 5/11 (45%)
C2H2 Zn finger 362..382 CDD:275368 6/19 (32%)
zf-H2C2_2 375..399 CDD:290200 10/23 (43%)
COG5048 386..>447 CDD:227381 31/115 (27%)
C2H2 Zn finger 390..410 CDD:275368 7/19 (37%)
zf-H2C2_2 403..426 CDD:290200 12/77 (16%)
C2H2 Zn finger 418..438 CDD:275368 8/19 (42%)
zf-H2C2_2 432..455 CDD:290200 15/22 (68%)
C2H2 Zn finger 446..466 CDD:275368 8/19 (42%)
zf-H2C2_2 459..481 CDD:290200 12/21 (57%)
C2H2 Zn finger 474..494 CDD:275368 7/19 (37%)
ZNF394NP_115540.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..61 13/57 (23%)
SCAN 60..170 CDD:128708 17/119 (14%)
KRAB_A-box 155..214 CDD:322003 16/58 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..201 6/18 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 231..285 16/55 (29%)
C2H2 Zn finger 337..353 CDD:275368 2/15 (13%)
COG5048 356..>420 CDD:227381 21/63 (33%)
C2H2 Zn finger 360..380 CDD:275368 6/19 (32%)
C2H2 Zn finger 388..408 CDD:275368 7/19 (37%)
zf-C2H2 414..436 CDD:306579 0/21 (0%)
C2H2 Zn finger 416..436 CDD:275368 0/19 (0%)
C2H2 Zn finger 444..463 CDD:275368 0/18 (0%)
SFP1 <464..543 CDD:227516 40/78 (51%)
C2H2 Zn finger 471..491 CDD:275368 8/19 (42%)
C2H2 Zn finger 499..519 CDD:275368 8/19 (42%)
C2H2 Zn finger 527..547 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.