DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and AT1G02030

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_171705.1 Gene:AT1G02030 / 839285 AraportID:AT1G02030 Length:267 Species:Arabidopsis thaliana


Alignment Length:235 Identity:49/235 - (20%)
Similarity:81/235 - (34%) Gaps:67/235 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 IPDQ--GYDHEMADQALSELSAEIEYLDQVEHDQLTESAHEDDAEVDLNSTEEEFVPSKSVRASI 269
            :|.|  .|...|||...            |..|:.:|             ||....||:. |:.:
plant    33 LPSQPESYSSSMADPGF------------VLQDRESE-------------TESSKKPSRK-RSRL 71

  Fly   270 HARNATKRRVNPR----RSATSTAS---VAVESSTSKTTDRGNPLKVRRGNSDSAGSKMSIKSEK 327
            :.|:.:..|....    :|.|:.|:   :.|:..:...|:: .|:.   ..||:|      .:|:
plant    72 NRRSISSLRHQQSNEEGKSETARAADIKIGVQELSESCTEQ-EPMS---SVSDAA------TTEE 126

  Fly   328 DISIGEVLARKHSGIKTKGGHKILLGDKKEFKYI-CDVCGNMYPSQSRLTEHIKVH--------- 382
            |:::..:|..:....|.:.........||..|:. |:.|..::.|...|..|...|         
plant   127 DVALSLMLLSRDKWEKEEEESDEERWKKKRNKWFECETCEKVFKSYQALGGHRASHKKKIAETDQ 191

  Fly   383 ------------SGVKPHECEICGHCFAQAQQLARHMNTH 410
                        |....|||.||...|...|.|..|..:|
plant   192 LGSDELKKKKKKSTSSHHECPICAKVFTSGQALGGHKRSH 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871
C2H2 Zn finger 362..382 CDD:275368 5/19 (26%)
zf-H2C2_2 375..399 CDD:290200 10/44 (23%)
COG5048 386..>447 CDD:227381 10/25 (40%)
C2H2 Zn finger 390..410 CDD:275368 7/19 (37%)
zf-H2C2_2 403..426 CDD:290200 3/8 (38%)
C2H2 Zn finger 418..438 CDD:275368
zf-H2C2_2 432..455 CDD:290200
C2H2 Zn finger 446..466 CDD:275368
zf-H2C2_2 459..481 CDD:290200
C2H2 Zn finger 474..494 CDD:275368
AT1G02030NP_171705.1 zf-C2H2_6 4..28 CDD:404748
zf-C2H2_6 160..185 CDD:404748 6/24 (25%)
zf-C2H2_6 208..231 CDD:404748 9/22 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I2552
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.