DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and AT3G60580

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_191617.1 Gene:AT3G60580 / 825229 AraportID:AT3G60580 Length:288 Species:Arabidopsis thaliana


Alignment Length:261 Identity:60/261 - (22%)
Similarity:93/261 - (35%) Gaps:87/261 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 SAHED---------DAEVDLNSTEEEFVPSKSV---------RASIHARNATKRRVNPRRSATST 288
            ::||:         :.|.|::|::.:|..:.||         .:|.:..|.|::|....|...|.
plant    29 NSHEEEQRPSQLSYETESDVSSSDPKFAFTSSVLLEDGESESESSRNVINLTRKRSKRTRKLDSF 93

  Fly   289 ASVAVE----------------SSTSKTTDRGNPLKVRRGNSDSAGSKMSI---KSEKDISIGEV 334
            .:..|:                ||.|.||.          ..|.|...|.:   |.:|:.|..||
plant    94 VTKKVKTSQLGYKPESDQEPPHSSASDTTT----------EEDLAFCLMMLSRDKWKKNKSNKEV 148

  Fly   335 LARKHSGIKTKGGHKILLGDKKEFKYICDVCGNMYPSQSRLTEHIKVHS---------------- 383
            :....:..:::|.:||.....|. :|.|:.||.::.|...|..|...|.                
plant   149 VEEIETEEESEGYNKINRATTKG-RYKCETCGKVFKSYQALGGHRASHKKNRVSNNKTEQRSETE 212

  Fly   384 -------GVKPHECEICGHCFAQAQQLARHMNTH-TGNRPYKCSYCPAAFADLSTRNKHHRIHTN 440
                   ..:.|||.||...||..|.|..|..:| .||              ||. |:..|:|.|
plant   213 YDNVVVVAKRIHECPICLRVFASGQALGGHKRSHGVGN--------------LSV-NQQRRVHRN 262

  Fly   441 E 441
            |
plant   263 E 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871
C2H2 Zn finger 362..382 CDD:275368 6/19 (32%)
zf-H2C2_2 375..399 CDD:290200 9/46 (20%)
COG5048 386..>447 CDD:227381 20/57 (35%)
C2H2 Zn finger 390..410 CDD:275368 8/19 (42%)
zf-H2C2_2 403..426 CDD:290200 5/23 (22%)
C2H2 Zn finger 418..438 CDD:275368 4/19 (21%)
zf-H2C2_2 432..455 CDD:290200 5/10 (50%)
C2H2 Zn finger 446..466 CDD:275368
zf-H2C2_2 459..481 CDD:290200
C2H2 Zn finger 474..494 CDD:275368
AT3G60580NP_191617.1 zf-C2H2_6 4..28 CDD:290623
zf-C2H2_6 172..197 CDD:290623 8/24 (33%)
zf-C2H2_6 223..246 CDD:290623 10/22 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I2552
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.