DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and ZNF70

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_068735.1 Gene:ZNF70 / 7621 HGNCID:13140 Length:446 Species:Homo sapiens


Alignment Length:367 Identity:105/367 - (28%)
Similarity:167/367 - (45%) Gaps:75/367 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 DDAAETQGGVF-HDEIEDGILVE--LEKDRIVHVK---NEQVEEDGIIEEVYDVYETYEGDL--- 206
            ::..|:|.|:| .:::.|..|.|  ||:..:::.:   .||.||:          :.|||:.   
Human    16 ENRLESQQGLFPGEDLGDPFLQERGLEQMAVIYKEIPLGEQDEEN----------DDYEGNFSLC 70

  Fly   207 --------IP--DQGYDHEMADQAL---SELSAEIEYLDQVEHDQLTESAHEDDAEVDLNSTEEE 258
                    ||  .:..|.|:..|..   |:||     :.|:.|.:  |.:..|.||.|...:   
Human    71 SSPVQHQSIPPGTRPQDDELFGQTFLQKSDLS-----MCQIIHSE--EPSPCDCAETDRGDS--- 125

  Fly   259 FVPSKSVRASIHARNATKRRVNPRRSATSTASVAVESSTSKTTDRGNPLKVRRGNSDSAGSKMSI 323
                        ..||..|...|   |...|......:.|:::.....|.:..|.          
Human   126 ------------GPNAPHRTPQP---AKPYACRECGKAFSQSSHLLRHLVIHTGE---------- 165

  Fly   324 KSEKDISIGEVLARKHSGIKTKGGHKIL-LGDKKEFKYICDVCGNMYPSQSRLTEHIKVHSGVKP 387
            |..:....|:..::....::    |:|: .|:|   .|.|..||..:...|.||:|.|:|:|.:|
Human   166 KPYECCECGKAFSQSSHLLR----HQIIHTGEK---PYECRECGKAFRQSSALTQHQKIHTGKRP 223

  Fly   388 HECEICGHCFAQAQQLARHMNTHTGNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCHKT 452
            :||..||..|:::..|.:|...|||.|||:|..|..:|...|..::|.:|||.::|:|||:|.|.
Human   224 YECRECGKDFSRSSSLRKHERIHTGERPYQCKECGKSFNQSSGLSQHRKIHTLKKPHECDLCGKA 288

  Fly   453 FTYTNTLKFHKMIHTGEKPHVCDVCGKGFPQAYKLRNHRVIH 494
            |.:.:.|..|:.||||:||:.||.|||.|.|:..|..||..|
Human   289 FCHRSHLIRHQRIHTGKKPYKCDECGKAFSQSSNLIEHRKTH 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871
C2H2 Zn finger 362..382 CDD:275368 8/19 (42%)
zf-H2C2_2 375..399 CDD:290200 12/23 (52%)
COG5048 386..>447 CDD:227381 24/60 (40%)
C2H2 Zn finger 390..410 CDD:275368 6/19 (32%)
zf-H2C2_2 403..426 CDD:290200 10/22 (45%)
C2H2 Zn finger 418..438 CDD:275368 5/19 (26%)
zf-H2C2_2 432..455 CDD:290200 11/22 (50%)
C2H2 Zn finger 446..466 CDD:275368 7/19 (37%)
zf-H2C2_2 459..481 CDD:290200 13/21 (62%)
C2H2 Zn finger 474..494 CDD:275368 10/19 (53%)
ZNF70NP_068735.1 C2H2 Zn finger 92..108 CDD:275368 5/20 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..138 8/41 (20%)
COG5048 138..442 CDD:227381 69/210 (33%)
C2H2 Zn finger 142..162 CDD:275368 2/19 (11%)
C2H2 Zn finger 170..190 CDD:275368 3/23 (13%)
C2H2 Zn finger 198..218 CDD:275368 8/19 (42%)
C2H2 Zn finger 226..246 CDD:275368 6/19 (32%)
C2H2 Zn finger 254..274 CDD:275368 5/19 (26%)
C2H2 Zn finger 282..302 CDD:275368 7/19 (37%)
C2H2 Zn finger 310..330 CDD:275368 10/19 (53%)
C2H2 Zn finger 338..358 CDD:275368
C2H2 Zn finger 366..386 CDD:275368
C2H2 Zn finger 394..413 CDD:275368
C2H2 Zn finger 421..441 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.