DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and ZNF708

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:XP_016882693.1 Gene:ZNF708 / 7562 HGNCID:12945 Length:587 Species:Homo sapiens


Alignment Length:517 Identity:128/517 - (24%)
Similarity:198/517 - (38%) Gaps:121/517 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CLQQPKEPMASIFNDDSEKDLTHMIRECGGVPIKQFDHYPDKICEKCFKVLK----MAFKFRETC 86
            ||:|.|||.....::.:.|                    |..:|....|.|:    :...|::..
Human    55 CLEQGKEPWNMKRHEMAAK--------------------PPAMCSHFAKDLRPEQYIKNSFQQVI 99

  Fly    87 QRSYGHLRQFVGPVEVEQRPPEKKGSETATKLEPDVDPDEAEQEPEHDEEDEDVDLDESHYAEAD 151
            .|.||......|...|::....|.|                     |...:..|...:|...:.|
Human   100 LRRYGKCGYQKGCKSVDEHKLHKGG---------------------HKGLNRCVTTTQSKIVQCD 143

  Fly   152 DAAETQGGVFHDEI------------------EDG----ILVELEKDRIVHV--KNEQVEEDGII 192
            ...:    |||...                  |.|    :|.:|.:..|:|.  |..:.||.|  
Human   144 KYVK----VFHKYSNAKRHKIRHTGKNPFKCKECGKSFCMLSQLTQHEIIHTGEKPYKCEECG-- 202

  Fly   193 EEVYDVYETYEGDLIPDQG---YDHEMADQALSELSAEIEYLDQVEHDQLTESAHEDDAEVDLNS 254
             :.:..........|...|   |..|...:|.::.|              |.:.|:     .:::
Human   203 -KAFKKSSNLTNHKIIHTGEKPYKCEECGKAFNQSS--------------TLTRHK-----IIHT 247

  Fly   255 TEEEFVPSKSVRASIHARNATKRRV---NPRRSATSTASVAVESSTSKTTDRGNPLKVRRGNS-- 314
            .|:.:...:..:|...:.|.||.::   ..:.........|.:.|::.|    |..|:..|..  
Human   248 GEKLYKCEECGKAFNRSSNLTKHKIVHTGEKPYKCEECGKAFKQSSNLT----NHKKIHTGEKPY 308

  Fly   315 --DSAGSKMSIKS----EKDISIG------EVLARKHSGIKTKGGHKILLGDKKEFKYICDVCGN 367
              ...|...::.|    .|.|..|      |...:..|...|...|||:..::|.:|  |:.||.
Human   309 KCGECGKAFTLSSHLTTHKRIHTGEKPYKCEECGKAFSVFSTLTKHKIIHTEEKPYK--CEECGK 371

  Fly   368 MYPSQSRLTEHIKVHSGVKPHECEICGHCFAQAQQLARHMNTHTGNRPYKCSYCPAAFADLSTRN 432
            .:...|.||.|..:|:|.||::||.||..|.::..|..|...|||.:||||..|..||:..|...
Human   372 AFNRSSHLTNHKVIHTGEKPYKCEECGKAFTKSSTLTYHKVIHTGKKPYKCEECGKAFSIFSILT 436

  Fly   433 KHHRIHTNERPYECDVCHKTFTYTNTLKFHKMIHTGEKPHVCDVCGKGFPQAYKLRNHRVIH 494
            ||..|||.::||:|:.|.|||.|::....||.|||||||:.|:.|||.|..:..|..|::||
Human   437 KHKVIHTEDKPYKCEECGKTFNYSSNFTNHKKIHTGEKPYKCEECGKSFILSSHLTTHKIIH 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 15/72 (21%)
C2H2 Zn finger 362..382 CDD:275368 7/19 (37%)
zf-H2C2_2 375..399 CDD:290200 12/23 (52%)
COG5048 386..>447 CDD:227381 27/60 (45%)
C2H2 Zn finger 390..410 CDD:275368 7/19 (37%)
zf-H2C2_2 403..426 CDD:290200 11/22 (50%)
C2H2 Zn finger 418..438 CDD:275368 7/19 (37%)
zf-H2C2_2 432..455 CDD:290200 12/22 (55%)
C2H2 Zn finger 446..466 CDD:275368 8/19 (42%)
zf-H2C2_2 459..481 CDD:290200 13/21 (62%)
C2H2 Zn finger 474..494 CDD:275368 7/19 (37%)
ZNF708XP_016882693.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.