DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and Zkscan3

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001139250.1 Gene:Zkscan3 / 72739 MGIID:1919989 Length:553 Species:Mus musculus


Alignment Length:415 Identity:111/415 - (26%)
Similarity:177/415 - (42%) Gaps:101/415 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 VHVKNEQVEEDGIIEEVYDVYETYEGDLIPDQGYDHEMADQALSELSAEIEYLDQVEHDQLTESA 243
            :|.| ||:.|..::|:...:   ..|:|   |.:..|....:..|:.|.:||||:...|...:..
Mouse    84 MHSK-EQILELLVLEQFLTI---LPGEL---QAWVREQHPDSGEEVVALLEYLDRQLDDTPPQVP 141

  Fly   244 HEDDAEVDLNSTEEEFVPSKSV--RASIHARNATKRRVNPRRSATSTASVAVE------------ 294
            .:||.        :|.:.||:|  .::..:.::....|.|.....|..|:..|            
Mouse   142 DDDDG--------QELLCSKAVLLTSAQGSESSQMEPVEPLLKQESLGSLPSEVRVTHVGHCGED 198

  Fly   295 --SSTSKTTDRGNPLKV----------------------RRGNSDSAGSKMSI------------ 323
              ::|..|::....||:                      :.|..:.:||.:|:            
Mouse   199 GVTATRLTSELQGLLKMEDVAPVLSPRWTEQDSSQMNLYKDGMQEHSGSLVSLDQDMQTKVRDLP 263

  Fly   324 --------KSEKDIS-IGE--------VLARKHSGIKTKGGHKILLGDKKEFKYICDVCGNMYPS 371
                    |.|:.:. :||        ..|.:..| |.:...|...|.:   ::.|..||..:..
Mouse   264 RAEEYRDQKPEQTVCFLGEDTVPIPTGAEASEQEG-KLQAAQKSATGTR---RFYCRECGKSFAQ 324

  Fly   372 QSRLTEHIKVHSGVKPHECEICGHCFAQAQQLARHMNTHTGNRPYKCSYCPAAFADLSTRNKHHR 436
            .|.|::|.::|:|:||:|||.||..|..:..|..|...|||.:||:|..|..||:..|...||.|
Mouse   325 SSGLSKHKRIHTGLKPYECEECGKAFIGSSALIIHQRVHTGEKPYECEECGKAFSHSSDLIKHQR 389

  Fly   437 IHTNERPYECDVCHKTFTYTNTLKFHKMIHTGEKPHVCDVCGKGFPQAYKLRNHRVIH------- 494
            .||.|:|||||.|.||||.:.:|..|..|||||||:.|::|.|.|.::..|..|:..|       
Mouse   390 THTGEKPYECDDCGKTFTQSCSLLEHHRIHTGEKPYQCNMCPKAFRRSSHLLRHQRTHTGDKDFF 454

  Fly   495 --------ERRGQSARESVAGLVSY 511
                    :.|.:|..|::...|||
Mouse   455 VPEPYWESQSRVESHWENIETPVSY 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871
C2H2 Zn finger 362..382 CDD:275368 6/19 (32%)
zf-H2C2_2 375..399 CDD:290200 12/23 (52%)
COG5048 386..>447 CDD:227381 29/60 (48%)
C2H2 Zn finger 390..410 CDD:275368 7/19 (37%)
zf-H2C2_2 403..426 CDD:290200 10/22 (45%)
C2H2 Zn finger 418..438 CDD:275368 8/19 (42%)
zf-H2C2_2 432..455 CDD:290200 15/22 (68%)
C2H2 Zn finger 446..466 CDD:275368 9/19 (47%)
zf-H2C2_2 459..481 CDD:290200 12/21 (57%)
C2H2 Zn finger 474..494 CDD:275368 6/19 (32%)
Zkscan3NP_001139250.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..49
SCAN 47..159 CDD:128708 23/89 (26%)
KRAB_A-box 213..267 CDD:383038 6/53 (11%)
zf-C2H2 313..335 CDD:333835 6/21 (29%)
C2H2 Zn finger 315..335 CDD:275368 6/19 (32%)
zf-H2C2_2 328..350 CDD:372612 11/21 (52%)
zf-C2H2 341..363 CDD:333835 8/21 (38%)
C2H2 Zn finger 343..363 CDD:275368 7/19 (37%)
COG5048 <367..514 CDD:227381 45/113 (40%)
C2H2 Zn finger 371..391 CDD:275368 8/19 (42%)
C2H2 Zn finger 399..419 CDD:275368 9/19 (47%)
C2H2 Zn finger 427..447 CDD:275368 6/19 (32%)
C2H2 Zn finger 481..501 CDD:275368
zf-C2H2 507..529 CDD:333835
C2H2 Zn finger 509..529 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4340
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.