DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and Zfp566

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_690027.1 Gene:Zfp566 / 72556 MGIID:1919806 Length:386 Species:Mus musculus


Alignment Length:396 Identity:112/396 - (28%)
Similarity:162/396 - (40%) Gaps:82/396 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 VFHDEIEDGILVELEKDRIVHVKNEQVEEDGIIEEVYDVY-----ETYEGDL------------- 206
            :|||               |::...|.|.:.:.||..|:|     |.|...|             
Mouse     7 LFHD---------------VYIDFSQEEWECLTEEQRDLYRDVMLENYSNLLSMVLESRCEAQKL 56

  Fly   207 -IPDQGYDHEMA-----------DQALSELSAEIEYLDQVEHDQLTESAHEDDAEVDLNSTEEEF 259
             :..:.|:.|.|           |...|.||:..|:....|..:  .|.....:|:.:|..:   
Mouse    57 FLKKELYEIETAQWEIMRKLTRQDLQCSSLSSAREWHGHRERQR--GSQERQFSELIINRDD--- 116

  Fly   260 VPSKSVRASIHARN---------ATKRRVNPRRSATSTASVAVESSTSK---TTDRG----NPLK 308
            ||:.|...|...:.         |:|......:..:..|:..:..:|.|   ..|.|    :|..
Mouse   117 VPTLSQCPSFRLQQIIKNKEKYCASKENREHYKHGSRFATHQIVRTTEKPYECKDCGKTFRHPSG 181

  Fly   309 VRRGNSDSAGSKMSIKSE--KDISIGEVLARKHSGIKTKGGHKILLGDKKEFKYICDVCGNMYPS 371
            :...:....|.|.....|  |....|..|.|.         |:|..|:|   .|.|..||..:.|
Mouse   182 LTHHHKIHTGKKPFECKECGKTFICGSDLTRH---------HRIHTGEK---PYECKDCGKAFSS 234

  Fly   372 QSRLTEHIKVHSGVKPHECEICGHCFAQAQQLARHMNTHTGNRPYKCSYCPAAFADLSTRNKHHR 436
            .|..|.|.::|:|.||:||:.||..|:......:|...|||.:||:|..|..||:..|...||.|
Mouse   235 GSNFTRHQRIHTGEKPYECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQR 299

  Fly   437 IHTNERPYECDVCHKTFTYTNTLKFHKMIHTGEKPHVCDVCGKGFPQAYKLRNHRVIHERRGQSA 501
            |||.|:||||..|.|.|...:.|..|:.|||||||:.|.:|||.:.|:.:|.:|..||  .|:.|
Mouse   300 IHTGEKPYECKECEKAFRSGSDLTRHQRIHTGEKPYECKICGKAYSQSSQLISHHRIH--GGKKA 362

  Fly   502 RESVAG 507
            .|...|
Mouse   363 YEDEDG 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871
C2H2 Zn finger 362..382 CDD:275368 7/19 (37%)
zf-H2C2_2 375..399 CDD:290200 11/23 (48%)
COG5048 386..>447 CDD:227381 28/60 (47%)
C2H2 Zn finger 390..410 CDD:275368 5/19 (26%)
zf-H2C2_2 403..426 CDD:290200 9/22 (41%)
C2H2 Zn finger 418..438 CDD:275368 8/19 (42%)
zf-H2C2_2 432..455 CDD:290200 14/22 (64%)
C2H2 Zn finger 446..466 CDD:275368 6/19 (32%)
zf-H2C2_2 459..481 CDD:290200 13/21 (62%)
C2H2 Zn finger 474..494 CDD:275368 7/19 (37%)
Zfp566NP_690027.1 KRAB 6..>48 CDD:214630 13/55 (24%)
KRAB 6..45 CDD:279668 13/52 (25%)
zf-C2H2 167..189 CDD:278523 3/21 (14%)
C2H2 Zn finger 169..189 CDD:275368 3/19 (16%)
zf-H2C2_2 182..204 CDD:290200 4/21 (19%)
COG5048 <193..355 CDD:227381 68/173 (39%)
C2H2 Zn finger 197..217 CDD:275368 6/28 (21%)
zf-H2C2_2 209..234 CDD:290200 10/36 (28%)
C2H2 Zn finger 225..245 CDD:275368 7/19 (37%)
zf-H2C2_2 237..262 CDD:290200 11/24 (46%)
C2H2 Zn finger 253..273 CDD:275368 5/19 (26%)
zf-H2C2_2 265..290 CDD:290200 10/24 (42%)
C2H2 Zn finger 281..301 CDD:275368 8/19 (42%)
zf-H2C2_2 294..318 CDD:290200 14/23 (61%)
C2H2 Zn finger 309..329 CDD:275368 6/19 (32%)
zf-H2C2_2 321..346 CDD:290200 13/24 (54%)
C2H2 Zn finger 337..357 CDD:275368 7/19 (37%)
C2H2 Zn finger 365..384 CDD:275368 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4340
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.