DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and Zfp558

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_082436.1 Gene:Zfp558 / 72230 MGIID:1921681 Length:407 Species:Mus musculus


Alignment Length:446 Identity:108/446 - (24%)
Similarity:171/446 - (38%) Gaps:105/446 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 PVEVEQRPPEKKG--SETATKLEPDVDPDEAEQEPEHDEEDEDVDLDESHYAEADDAAETQGGVF 161
            |:..|:....|||  :|..|.|          .|.....||..|...:..:|..|....|     
Mouse    17 PLSPEEGQMGKKGLATEFLTSL----------LEELVSFEDVTVQFTQEEWALLDPLQRT----- 66

  Fly   162 HDEIEDGILVE-----------LEKDRIVHVKNEQVEEDGIIEEVYDVYETYEGDLIPDQGYDHE 215
               :...:.:|           |:|..::   ::..|||.:|.|        :..:||  |...:
Mouse    67 ---LYRNVTLENWKNLASLGQHLDKPNLI---SQLEEEDKVIRE--------DRGIIP--GIHPD 115

  Fly   216 MADQALSELSAEIEYLDQVEHD------QLTESAHEDDAEVDLN------STEEEFVPSKSVRAS 268
            :.....::.......:...|||      ||.|..|......:.|      ||:......|.:...
Mouse   116 LEKVLKAKWLTPKNLIFSKEHDNGGKTVQLEERGHHGMKVNECNQCFKVFSTKSNLTQHKRIHTG 180

  Fly   269 IHARNATKRRVNPRRSATSTASVAVESSTSKTTDRGNPLKVRRGN------------SDSAGSKM 321
            ....:.|:            ...:..|.:..|..|    ::..|.            ||.:..::
Mouse   181 EKPYDCTQ------------CGKSFRSKSYLTVHR----RIHNGEKPFECNHCGKAFSDPSSLRL 229

  Fly   322 SIK---SEKDISIGEVL--------ARKHSGIKTKGGHKILLGDKKEFKYICDVCGNMYPSQSRL 375
            .::   .||.....:..        .:.|..|.|.|          |.::.|..||..:.::|.|
Mouse   230 HVRIHTGEKPYECSQCFHVFRTSCNLKSHKRIHTGG----------ENQHECSQCGKAFSTRSSL 284

  Fly   376 TEHIKVHSGVKPHECEICGHCFAQAQQLARHMNTHTGNRPYKCSYCPAAFADLSTRNKHHRIHTN 440
            |.|..:|:|.||.||:.||..|.::..|.:|:.||||.:||:|:.|..:|:...:...|.||||.
Mouse   285 TGHNSIHTGEKPFECQECGKTFRKSSYLTQHLRTHTGEKPYECNECGKSFSSSFSLTVHKRIHTG 349

  Fly   441 ERPYECDVCHKTFTYTNTLKFHKMIHTGEKPHVCDVCGKGFPQAYKLRNHRVIHER 496
            |:||||..|.|.|...:.:|.|.|.|||:||:.|:.|||.|.....|..|:.:|.|
Mouse   350 EKPYECSHCGKAFNNLSAVKKHLMTHTGQKPYGCNHCGKSFTSNSYLSVHKRVHNR 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871
C2H2 Zn finger 362..382 CDD:275368 7/19 (37%)
zf-H2C2_2 375..399 CDD:290200 12/23 (52%)
COG5048 386..>447 CDD:227381 27/60 (45%)
C2H2 Zn finger 390..410 CDD:275368 6/19 (32%)
zf-H2C2_2 403..426 CDD:290200 10/22 (45%)
C2H2 Zn finger 418..438 CDD:275368 5/19 (26%)
zf-H2C2_2 432..455 CDD:290200 13/22 (59%)
C2H2 Zn finger 446..466 CDD:275368 7/19 (37%)
zf-H2C2_2 459..481 CDD:290200 12/21 (57%)
C2H2 Zn finger 474..494 CDD:275368 7/19 (37%)
Zfp558NP_082436.1 KRAB 43..100 CDD:214630 11/67 (16%)
COG5048 <125..403 CDD:227381 80/303 (26%)
C2H2 Zn finger 158..178 CDD:275368 4/19 (21%)
C2H2 Zn finger 186..206 CDD:275368 4/35 (11%)
C2H2 Zn finger 214..234 CDD:275368 2/19 (11%)
C2H2 Zn finger 242..262 CDD:275368 1/19 (5%)
C2H2 Zn finger 271..291 CDD:275368 7/19 (37%)
C2H2 Zn finger 299..319 CDD:275368 6/19 (32%)
C2H2 Zn finger 327..347 CDD:275368 5/19 (26%)
C2H2 Zn finger 355..375 CDD:275368 7/19 (37%)
C2H2 Zn finger 383..403 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4340
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.