DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and Zscan25

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001074900.1 Gene:Zscan25 / 666311 MGIID:3647079 Length:543 Species:Mus musculus


Alignment Length:422 Identity:106/422 - (25%)
Similarity:167/422 - (39%) Gaps:91/422 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 VGPVEV--EQRPPEKKG------SETATKLEPDVDPDEAEQE------------PEHDEEDEDVD 141
            :|||||  |...|:.:|      |.|....:...|..:|.||            |.....|::: 
Mouse   153 LGPVEVKPEWGIPQGEGVQSLGPSTTEQLSQGPGDGTQAFQEQALPILHVGPGLPSVSARDQEM- 216

  Fly   142 LDESHYAEADDAAETQG-GVFHDEIEDGILVELEKDRIVHVKNEQVEEDGIIEEVYDVYETYEGD 205
                  |....||.:|| |.|.|     :.:...::...||...|::..|      :..::.:..
Mouse   217 ------AAGFLAATSQGLGPFKD-----MTLGFPEEEWRHVAPAQIDCFG------EYVDSQDCG 264

  Fly   206 LIPDQGYDHEMADQALSELSAEIEYLDQVEHDQLTESAHEDDAEV--DLNSTEEEFVPSKSVRAS 268
            ::|..|...:.|.....:|......|       .::...|.|.::  ...:.|:|          
Mouse   265 VLPGAGSKEKEAKPQQEDLKRAFVGL-------TSDGFGEADIQIPGPGGTCEQE---------- 312

  Fly   269 IHARNATKRRVNPRRSATSTASVAVESSTSKTTDRGNPLKVRRGNSDSAGSKMSI-KSEKDISIG 332
                        |..|.||...:       .....|.||      .|:..:..|. |..:....|
Mouse   313 ------------PGSSGTSLPGL-------PAPQHGVPL------PDTLNTHNSFWKPFQCPECG 352

  Fly   333 EVLARKHSGIKTKGGHKILLGDKKEFKYICDVCGNMYPSQSRLTEHIKVHSGVKPHECEICGHCF 397
            :..:|..:.::.:..|:    ::|.|.  |..||..:..:..||:|.:.|.|.:|:.|..|...|
Mouse   353 KGFSRSSNLVRHQRTHE----EEKSFG--CVECGKGFTLREYLTKHQRTHLGKRPYVCGECWKTF 411

  Fly   398 AQAQQLARHMNTHTGNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCHKTFTYTNTLKFH 462
            :|...|..|..:|||.:|||||.|...|:.......|.|.||.|:||.|: |.|:|:....|..|
Mouse   412 SQRHHLEVHQRSHTGEKPYKCSDCWKGFSRRQHLLVHRRTHTGEKPYTCE-CGKSFSRNANLAVH 475

  Fly   463 KMIHTGEKPHVCDVCGKGFPQAYKLRNHRVIH 494
            :..||||||:.|.||||.|.:..:|..|:.||
Mouse   476 RRAHTGEKPYGCQVCGKRFSKGERLVRHQRIH 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871
C2H2 Zn finger 362..382 CDD:275368 6/19 (32%)
zf-H2C2_2 375..399 CDD:290200 9/23 (39%)
COG5048 386..>447 CDD:227381 24/60 (40%)
C2H2 Zn finger 390..410 CDD:275368 6/19 (32%)
zf-H2C2_2 403..426 CDD:290200 11/22 (50%)
C2H2 Zn finger 418..438 CDD:275368 6/19 (32%)
zf-H2C2_2 432..455 CDD:290200 11/22 (50%)
C2H2 Zn finger 446..466 CDD:275368 6/19 (32%)
zf-H2C2_2 459..481 CDD:290200 13/21 (62%)
C2H2 Zn finger 474..494 CDD:275368 8/19 (42%)
Zscan25NP_001074900.1 SCAN 38..120 CDD:396558
KRAB_A-box 230..>258 CDD:413388 6/38 (16%)
COG5048 <338..531 CDD:227381 61/177 (34%)
C2H2 Zn finger 348..368 CDD:275368 2/19 (11%)
C2H2 Zn finger 376..396 CDD:275368 6/19 (32%)
C2H2 Zn finger 404..424 CDD:275368 6/19 (32%)
C2H2 Zn finger 432..452 CDD:275368 6/19 (32%)
C2H2 Zn finger 460..479 CDD:275368 6/19 (32%)
C2H2 Zn finger 487..507 CDD:275368 8/19 (42%)
C2H2 Zn finger 515..534 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4340
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.