DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and Zscan4b

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001172102.1 Gene:Zscan4b / 665780 MGIID:3645447 Length:505 Species:Mus musculus


Alignment Length:562 Identity:120/562 - (21%)
Similarity:187/562 - (33%) Gaps:202/562 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 STQK----WIVCRVCLQ---QPKEPMASIFNDDSEKDLTHMIRECGGVPIKQF---DHYPDKICE 70
            :||:    |.:....||   |.||.|.|                  .:.::||   .|..||   
Mouse    51 ATQELQSLWKMFNSWLQPEKQTKEQMIS------------------QLVLEQFLLTGHCKDK--- 94

  Fly    71 KCFKVLKMAFKFRETCQRSYGHLRQFV---------GPVEV------------EQRPPEK----- 109
                     :...|..:.|...:|:|:         .||.|            |..|.::     
Mouse    95 ---------YALTEKWKASGSDMRRFMESLTDECLKPPVMVHVSMQGQEALFSENMPLKEVIKLL 150

  Fly   110 KGSETATKLEPD-----VD--PDEAEQEPEHDEEDE--------DVDLDESHYA-EADDAAETQG 158
            |..::||:..||     ||  .|......:.:.|:|        :|::.||... |.|....||.
Mouse   151 KQQQSATRPIPDNAQMPVDTTQDRLLATGQENSENECNTSCNATEVNVGESCSGNEKDSLLITQK 215

  Fly   159 GVFHDEIEDGILVEL-------EKDRIVH------------VKNEQ----VEEDGIIEEVYDVYE 200
            ...|:..|..::.:.       .:|...|            |..|:    :..:.|.|:..:.|.
Mouse   216 EQNHEHEEGNVVCQFPRGARRASQDTSSHHVDFPSALTPADVPMEEQPMDLSRENISEDKNNCYN 280

  Fly   201 T--------YEGDLIPDQGYDHEMADQALSELSAEIEYLDQVEHDQLTESAHEDDAEVDLNSTEE 257
            |        |.||.||....|....::.:.....|:                   .::...    
Mouse   281 TSRNAATQVYSGDNIPRNKTDSLFINKRIYHPEPEV-------------------GDIPYG---- 322

  Fly   258 EFVPSKSVRASIHARNATKRRVNPRRSATSTASVAVESSTSKTTDRGNPLKVRRGNSDSAGSKMS 322
              ||..|.|||               ..|||..                       .:|.|... 
Mouse   323 --VPQDSTRAS---------------QGTSTCL-----------------------QESLGECF- 346

  Fly   323 IKSEKDISIGEVLARKHSGIKTKGGHKI---LLGDKKEFKYICDVCGNMYPSQSRLTEHIKVHSG 384
              ||||       .|:..|::::....|   :||...|....|:            :...:.|..
Mouse   347 --SEKD-------PREVPGLQSRQEQPISDPVLGKNHEANLPCE------------SHQKRFHRD 390

  Fly   385 VKPHECEICGHCFAQAQQLARHMNTHTGNR-PYKCSYCPAAFADLSTRNKHHRIHTNERPYECDV 448
            .|.::||.|...|..|:.|:.|..||...: ...|..|...|..:|....|..||.:|:|::|..
Mouse   391 AKLYKCEECSRMFKHARSLSSHQRTHLNKKSELLCITCQKIFKRVSDLRTHEIIHMSEKPFKCST 455

  Fly   449 CHKTFTYTNTLKFHKMIHTGEKPHVCDVCGKGFPQAYKLRNH 490
            |.|:|::...||:|:||||||.|:||.:|.:.|.|:.....|
Mouse   456 CEKSFSHKTNLKYHEMIHTGEMPYVCSLCSRRFRQSSTYHRH 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 14/78 (18%)
C2H2 Zn finger 362..382 CDD:275368 1/19 (5%)
zf-H2C2_2 375..399 CDD:290200 6/23 (26%)
COG5048 386..>447 CDD:227381 19/61 (31%)
C2H2 Zn finger 390..410 CDD:275368 7/19 (37%)
zf-H2C2_2 403..426 CDD:290200 6/23 (26%)
C2H2 Zn finger 418..438 CDD:275368 5/19 (26%)
zf-H2C2_2 432..455 CDD:290200 9/22 (41%)
C2H2 Zn finger 446..466 CDD:275368 8/19 (42%)
zf-H2C2_2 459..481 CDD:290200 13/21 (62%)
C2H2 Zn finger 474..494 CDD:275368 5/17 (29%)
Zscan4bNP_001172102.1 SCAN <51..117 CDD:295388 19/95 (20%)
zf-C2H2 394..416 CDD:278523 7/21 (33%)
C2H2 Zn finger 396..416 CDD:275368 7/19 (37%)
C2H2 Zn finger 425..445 CDD:275368 5/19 (26%)
zf-H2C2_2 437..462 CDD:290200 9/24 (38%)
zf-CHCC <441..489 CDD:295045 22/47 (47%)
C2H2 Zn finger 453..473 CDD:275368 8/19 (42%)
C2H2 Zn finger 481..499 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.