DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and Zfp113

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_062721.2 Gene:Zfp113 / 56314 MGIID:1929116 Length:439 Species:Mus musculus


Alignment Length:308 Identity:97/308 - (31%)
Similarity:140/308 - (45%) Gaps:57/308 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 DVY-----ETYEGDLIPDQGYDHEMADQALSELSAEIE-----YLDQVEHDQLTESAHEDDAEVD 251
            |:|     |.| |::....|......|:.:||.....|     :...|......|.|:|.  ||.
Mouse    75 DLYRDVMLENY-GNVFSLDGDSKTGNDRVISEGMGSCEMILGRFQKDVSQGLKFEEAYEQ--EVS 136

  Fly   252 LNSTEEEFVPSKSVRASIHARNATKRRVNPRRSATSTASVAVESSTSKTTDRGNPLKVRRGNSDS 316
            |..               ...|::..|:|  |.......|.||...:...:| |......|||.:
Mouse   137 LQR---------------QLGNSSVGRLN--RKIQEFHQVRVEEKLTHIGER-NKKYSEFGNSFT 183

  Fly   317 AGSKMSIKSEKDISIGEVLARKHSGIKTKGGHKILLGDKKEFKYICDVCGNMYPSQSRLTEHIKV 381
            ..||:       ||        |        .::.:|||   .:.||.|...:...|.|.:|.::
Mouse   184 VNSKL-------IS--------H--------QRLQMGDK---PHKCDECSKSFNRTSDLIQHQRI 222

  Fly   382 HSGVKPHECEICGHCFAQAQQLARHMNTHTGNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYEC 446
            |:|.||:||..||..|:|:..|.:|...|||.:||:|..|...|:..|....|.||||.|:||||
Mouse   223 HTGEKPYECSECGKAFSQSAHLIQHQRIHTGEKPYECKDCGKTFSCSSALILHQRIHTGEKPYEC 287

  Fly   447 DVCHKTFTYTNTLKFHKMIHTGEKPHVCDVCGKGFPQAYKLRNHRVIH 494
            :.|.|||::::||..|:.|||||||:.|:.|||.|.::..|.:|:.||
Mouse   288 NECGKTFSWSSTLTHHQRIHTGEKPYACNECGKAFSRSSTLIHHQRIH 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871
C2H2 Zn finger 362..382 CDD:275368 6/19 (32%)
zf-H2C2_2 375..399 CDD:290200 11/23 (48%)
COG5048 386..>447 CDD:227381 28/60 (47%)
C2H2 Zn finger 390..410 CDD:275368 7/19 (37%)
zf-H2C2_2 403..426 CDD:290200 9/22 (41%)
C2H2 Zn finger 418..438 CDD:275368 6/19 (32%)
zf-H2C2_2 432..455 CDD:290200 14/22 (64%)
C2H2 Zn finger 446..466 CDD:275368 8/19 (42%)
zf-H2C2_2 459..481 CDD:290200 13/21 (62%)
C2H2 Zn finger 474..494 CDD:275368 7/19 (37%)
Zfp113NP_062721.2 zf-H2C2_2 243..268 CDD:290200 10/24 (42%)
C2H2 Zn finger 259..279 CDD:275368 6/19 (32%)
zf-H2C2_2 275..295 CDD:290200 13/19 (68%)
C2H2 Zn finger 287..307 CDD:275368 8/19 (42%)
zf-H2C2_2 300..324 CDD:290200 14/23 (61%)
C2H2 Zn finger 315..335 CDD:275368 7/19 (37%)
zf-H2C2_2 331..352 CDD:290200 3/5 (60%)
C2H2 Zn finger 343..363 CDD:275368
zf-H2C2_2 355..380 CDD:290200
C2H2 Zn finger 371..391 CDD:275368
zf-H2C2_2 384..408 CDD:290200
C2H2 Zn finger 399..419 CDD:275368
KRAB 52..>92 CDD:214630 5/17 (29%)
KRAB 52..91 CDD:279668 5/16 (31%)
COG5048 <169..415 CDD:227381 73/194 (38%)
C2H2 Zn finger 179..195 CDD:275368 8/38 (21%)
zf-C2H2 201..223 CDD:278523 6/21 (29%)
C2H2 Zn finger 203..223 CDD:275368 6/19 (32%)
zf-H2C2_2 215..240 CDD:290200 11/24 (46%)
C2H2 Zn finger 231..251 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4340
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.