DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and ZSCAN32

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001271456.1 Gene:ZSCAN32 / 54925 HGNCID:20812 Length:697 Species:Homo sapiens


Alignment Length:365 Identity:107/365 - (29%)
Similarity:152/365 - (41%) Gaps:78/365 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 ADDAAETQGGVFHDEIEDGILVELEKDRIVHVKNEQVE-EDGIIEEVYDVYETYEGDLIPDQGYD 213
            |.||...|.|   .:||.|   ||.     |...|..| |||.::                 |.|
Human   349 ASDAVPGQEG---SDIEAG---ELN-----HQNGEPTEVEDGTVD-----------------GAD 385

  Fly   214 HEMAD-----QALSELSAEI--------EYLDQVEHDQLTESAHEDDAEVDLNSTEEEFVPSKSV 265
            .:..|     |.:.:|...:        |:.::::.:.|   ..:|..||::|..    :..||.
Human   386 RDEKDFRNPGQEVRKLDLPVLFPNRLGFEFKNEIKKENL---KWDDSEEVEINKA----LQRKSR 443

  Fly   266 RASIHARNATKRRVNPRRSATSTASVAVESS-TSKTTDRGNPLKVRRGNSDS---AGSKMSIKS- 325
            ....|                |.....:||. ||:...|.:|     |.|:.   :..|||.:| 
Human   444 GVYWH----------------SELQKGLESEPTSRRQCRNSP-----GESEEKTPSQEKMSHQSF 487

  Fly   326 -EKDISIGEVLARKHSGIKTKGGHKILLGDKKEFKYICDVCGNMYPSQSRLTEHIKVHSGVKPHE 389
             .:|.:...:|..|:........||..|  |.|....|..||..:...|.|..|.::|:|.|||:
Human   488 CARDKACTHILCGKNCSQSVHSPHKPAL--KLEKVSQCPECGKTFSRSSYLVRHQRIHTGEKPHK 550

  Fly   390 CEICGHCFAQAQQLARHMNTHTGNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCHKTFT 454
            |..||..|::...|..|:.||||.|||:|..|..:|...|:...|.|.||.|:||:|.||.|.|.
Human   551 CSECGKGFSERSNLTAHLRTHTGERPYQCGQCGKSFNQSSSLIVHQRTHTGEKPYQCIVCGKRFN 615

  Fly   455 YTNTLKFHKMIHTGEKPHVCDVCGKGFPQAYKLRNHRVIH 494
            .::....|:.|||||.|:.|.||||.|..:.....||..|
Human   616 NSSQFSAHRRIHTGESPYKCAVCGKIFNNSSHFSAHRKTH 655

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871
C2H2 Zn finger 362..382 CDD:275368 6/19 (32%)
zf-H2C2_2 375..399 CDD:290200 11/23 (48%)
COG5048 386..>447 CDD:227381 27/60 (45%)
C2H2 Zn finger 390..410 CDD:275368 6/19 (32%)
zf-H2C2_2 403..426 CDD:290200 11/22 (50%)
C2H2 Zn finger 418..438 CDD:275368 6/19 (32%)
zf-H2C2_2 432..455 CDD:290200 12/22 (55%)
C2H2 Zn finger 446..466 CDD:275368 6/19 (32%)
zf-H2C2_2 459..481 CDD:290200 12/21 (57%)
C2H2 Zn finger 474..494 CDD:275368 8/19 (42%)
ZSCAN32NP_001271456.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
SCAN 33..142 CDD:128708
SCAN 33..121 CDD:280241
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..177
KRAB_A-box 218..250 CDD:295379
Myb_DNA-bind_4 253..334 CDD:290549
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 347..395 19/73 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 451..482 8/35 (23%)
COG5048 <455..668 CDD:227381 76/208 (37%)
zf-C2H2 522..543 CDD:278523 6/20 (30%)
C2H2 Zn finger 523..543 CDD:275368 6/19 (32%)
zf-H2C2_2 535..559 CDD:290200 10/23 (43%)
C2H2 Zn finger 551..571 CDD:275368 6/19 (32%)
zf-H2C2_2 563..588 CDD:290200 12/24 (50%)
C2H2 Zn finger 579..599 CDD:275368 6/19 (32%)
zf-H2C2_2 591..616 CDD:290200 12/24 (50%)
C2H2 Zn finger 607..627 CDD:275368 6/19 (32%)
zf-H2C2_2 623..644 CDD:290200 13/20 (65%)
C2H2 Zn finger 635..655 CDD:275368 8/19 (42%)
zf-H2C2_2 647..671 CDD:290200 3/9 (33%)
zf-C2H2 661..683 CDD:278523
C2H2 Zn finger 663..683 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.