DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and Zkscan6

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001289303.1 Gene:Zkscan6 / 52712 MGIID:1289293 Length:556 Species:Mus musculus


Alignment Length:450 Identity:110/450 - (24%)
Similarity:176/450 - (39%) Gaps:96/450 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 QRPPEKKGSET---ATKLEPDVDPDEAEQEPEHDEEDEDVDLDESHYA-----------EAD--- 151
            |..|.:|.:.|   ..||||.:     |.||..:...:|:.|..|..|           |:|   
Mouse   137 QEIPFEKENLTHCPGDKLEPAL-----EVEPSLEVAPQDLPLQNSSSATGELLSHGVKEESDMEP 196

  Fly   152 ---------DAAETQGGVFHDEIEDGILVELEKDRIVHVKNEQVEEDGIIEEVYD-VYETYEGDL 206
                     .|...:..|...|:...:|..|::::..|:.:.|.      |:.:| :.||| |.:
Mouse   197 ELALAASQLPARPEERPVRDQELGTAVLPPLQEEQWRHLDSTQK------EQYWDLMLETY-GKM 254

  Fly   207 IPD-QGYDHEMADQA-LSELSAEIEYL---------------DQVEHDQ--LTESAHEDDAEVDL 252
            :.. .|..:...|.. |:|...|:..|               |:.|:|:  |....|.|...:|:
Mouse   255 VSGVAGISNSKPDLTNLAEYGEELVGLHLHGAEKMARLPCKEDRQENDKENLNLENHRDQGCLDV 319

  Fly   253 NSTEEEFVPSKSVRASIHARNATKRRVNPRRSATSTASVAVESSTSKTTDRGNPLKVRRGNSDSA 317
            ........|.::..:.....:      .|.|....:...|:|:...:.|. .:.....||:....
Mouse   320 FCQASGEAPPQTALSDFFGES------EPHRFGGDSVPEALENHQGEGTG-AHLFPYERGSGKQP 377

  Fly   318 GSKMSIKSEKDISIGEVLARKHSGIKTKGGHKILLGDKKEFKY-------------ICDVCGNMY 369
            |..:     :..|:||:.|             :.|.:|:|...             .|..||..:
Mouse   378 GQHI-----QSSSLGELTA-------------LWLEEKREASQKGQARSPMAQKLPTCRECGKTF 424

  Fly   370 PSQSRLTEHIKVHSGVKPHECEICGHCFAQAQQLARHMNTHTGNRPYKCSYCPAAFADLSTRNKH 434
            ...|:|..|.:.|:|.....|.||...|.::....:|..||||.:|.||.||...|:|.|....|
Mouse   425 YRNSQLVFHQRTHTGETYFHCHICKKAFLRSSDFVKHQRTHTGEKPCKCDYCGKGFSDFSGLRHH 489

  Fly   435 HRIHTNERPYECDVCHKTFTYTNTLKFHKMIHTGEKPHVCDVCGKGFPQAYKLRNHRVIH 494
            .:|||.|:||:|.:|.|:|...:....|:.:||||||:.|..|||.|..:..|..|:..|
Mouse   490 EKIHTGEKPYKCPLCEKSFIQRSNFNRHQRVHTGEKPYKCTHCGKQFSWSSSLDKHQRSH 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871
C2H2 Zn finger 362..382 CDD:275368 6/19 (32%)
zf-H2C2_2 375..399 CDD:290200 8/23 (35%)
COG5048 386..>447 CDD:227381 24/60 (40%)
C2H2 Zn finger 390..410 CDD:275368 5/19 (26%)
zf-H2C2_2 403..426 CDD:290200 10/22 (45%)
C2H2 Zn finger 418..438 CDD:275368 7/19 (37%)
zf-H2C2_2 432..455 CDD:290200 11/22 (50%)
C2H2 Zn finger 446..466 CDD:275368 5/19 (26%)
zf-H2C2_2 459..481 CDD:290200 11/21 (52%)
C2H2 Zn finger 474..494 CDD:275368 7/19 (37%)
Zkscan6NP_001289303.1 SCAN 37..144 CDD:383046 2/6 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 169..195 6/25 (24%)
KRAB_A-box 229..278 CDD:383038 12/55 (22%)
C2H2 Zn finger 417..437 CDD:275368 6/19 (32%)
COG5048 <428..541 CDD:227381 45/112 (40%)
C2H2 Zn finger 445..465 CDD:275368 5/19 (26%)
C2H2 Zn finger 473..493 CDD:275368 7/19 (37%)
C2H2 Zn finger 501..521 CDD:275368 5/19 (26%)
C2H2 Zn finger 529..549 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4340
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.