DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and Zscan4f

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:XP_578644.3 Gene:Zscan4f / 503124 RGDID:1563625 Length:508 Species:Rattus norvegicus


Alignment Length:546 Identity:119/546 - (21%)
Similarity:196/546 - (35%) Gaps:125/546 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 HASPA-----------------------AAATSTQK-WIVCRVCLQ---QPKEPMAS-------- 36
            ||||.                       :|....|| |.:....||   |.||.|.|        
  Rat    29 HASPVQWGEIFSDSSSAQLNFSPSKNGFSAKQELQKLWQMFNSWLQPEKQSKEQMISQLVLEQFL 93

  Fly    37 IFNDDSEKDLTHMIRECGGVPIKQFDHYPDKICEKCFKVLKMAFKFRETCQRSYGH---LRQFVG 98
            :.....:..:...|.|..|   :....:.:.:.::|.|...|.:...:..:..:..   |::.:.
  Rat    94 LTGHCKDNFVLKEIWEASG---RNMGRFLEGLTDECLKPPAMVYVSMQGLEAQFSENMPLKEVIK 155

  Fly    99 PVEVEQRPPEKKGSETATKLEPDVDPDEAEQEPEHDEEDEDVDLDESHYAEADDAAETQGGVFHD 163
            .:|.:         :.||.|.|     |:.|.|.|..||..:...:    |..:...|.|.....
  Rat   156 ILEQQ---------KLATGLTP-----ESTQMPVHIAEDILLATGQ----ENSENKHTSGNSTEV 202

  Fly   164 EIEDGILVELEKDRIVHVKNEQV--EEDGIIEEVYDVYETYEGDLIPDQGYDHEMADQALS---- 222
            .|.|..... |.:.::.::.||.  :|||:     |.::..:|.........|.:  :.||    
  Rat   203 NIGDSSTGH-EMNSLLIIQKEQCPEQEDGL-----DSFQFTQGARASQGNSSHHV--EFLSAHTW 259

  Fly   223 -----ELSAEIEYLDQVEHDQLTESAHEDDAEVDLNSTEEEFVPSKSVRASIHARNATKRRVNPR 282
                 |....|.|...:..|:      |:......|:|:|.           .|.|...|:::  
  Rat   260 RDIPMEAQPVIFYRTNISEDR------EECCTTSKNATQEN-----------SADNIPMRKMD-- 305

  Fly   283 RSATSTASVAVESSTSKTTDRGNPLK--VRRGNSDSAGSKMSIKSEKDISIGEVLARKHSGIKTK 345
                   ||.:.........:...:.  |.:|.:.|.|:..|.:....::..|...|...|:.::
  Rat   306 -------SVFINQRMYHPEPKMGDVSCGVPQGFTRSPGTSTSQQESLGLTFSEDDPRDIPGVPSR 363

  Fly   346 ----GGHKILLGDKKEFKYICDVCGNMYPSQSRLTEHIK-VHSGVKPHECEICGHCFAQAQQLAR 405
                ....:||...:|             :.|....|.| :|.|.|.:.||.|...|..|..|:.
  Rat   364 PEKLSSEAVLLYQNQE-------------ANSTSKSHQKRLHVGPKQYNCEECPRTFKYASHLSL 415

  Fly   406 HMNTHTGNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCHKTFTYTNTLKFHKMIHTGEK 470
            |..||...:.:.|..|...|...|....|..||..|:|::|..|.|:|::...||.|:.||||||
  Rat   416 HQRTHQNKKAFVCPTCQKTFKRASDLRCHEIIHNPEKPFKCSTCEKSFSHKTNLKAHERIHTGEK 480

  Fly   471 PHVCDVCGKGFPQAYKLRNH-RVIHE 495
            |:||.:|...|.|:.....| |.:|:
  Rat   481 PYVCSLCSHRFCQSSTYNRHLRNVHK 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 14/86 (16%)
C2H2 Zn finger 362..382 CDD:275368 3/20 (15%)
zf-H2C2_2 375..399 CDD:290200 9/24 (38%)
COG5048 386..>447 CDD:227381 19/60 (32%)
C2H2 Zn finger 390..410 CDD:275368 7/19 (37%)
zf-H2C2_2 403..426 CDD:290200 6/22 (27%)
C2H2 Zn finger 418..438 CDD:275368 5/19 (26%)
zf-H2C2_2 432..455 CDD:290200 9/22 (41%)
C2H2 Zn finger 446..466 CDD:275368 7/19 (37%)
zf-H2C2_2 459..481 CDD:290200 13/21 (62%)
C2H2 Zn finger 474..494 CDD:275368 6/20 (30%)
Zscan4fXP_578644.3 SCAN 53..124 CDD:413396 14/73 (19%)
SFP1 <349..472 CDD:227516 36/135 (27%)
zf-C2H2 398..420 CDD:395048 7/21 (33%)
C2H2 Zn finger 400..420 CDD:275368 7/19 (37%)
C2H2 Zn finger 428..448 CDD:275368 5/19 (26%)
zf-C2H2 454..476 CDD:395048 7/21 (33%)
C2H2 Zn finger 456..476 CDD:275368 7/19 (37%)
C2H2 Zn finger 484..502 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.