DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and Vom1r42

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:XP_017445028.1 Gene:Vom1r42 / 494303 RGDID:1549734 Length:306 Species:Rattus norvegicus


Alignment Length:47 Identity:10/47 - (21%)
Similarity:16/47 - (34%) Gaps:15/47 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   437 IHTNERPYECDVCHKTFTYTNTLKFHKMIHTGEKPHVCDVCGKGFPQ 483
            |||.:.....|:..:..|:.|.|               .:..||.|:
  Rat    36 IHTGKHLMPKDLIIEHLTFANCL---------------SIISKGIPR 67

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871
C2H2 Zn finger 362..382 CDD:275368
zf-H2C2_2 375..399 CDD:290200
COG5048 386..>447 CDD:227381 3/9 (33%)
C2H2 Zn finger 390..410 CDD:275368
zf-H2C2_2 403..426 CDD:290200