DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and ZIPIC

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_651765.1 Gene:ZIPIC / 43566 FlyBaseID:FBgn0039740 Length:457 Species:Drosophila melanogaster


Alignment Length:500 Identity:120/500 - (24%)
Similarity:194/500 - (38%) Gaps:104/500 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VCRVCLQQPKEPMASIFNDDSEKD---LTHMIRECGGVPIKQFDHYPDKICEKCFKVLKMAFKFR 83
            :|:..::.||:    |..|.....   ::.::.:|..............||:||.:.|....|..
  Fly     5 ICQFSVRVPKD----IHTDTVGHPPVLISELVLQCTRGTNYVLTEESSTICKKCCEKLARYHKSI 65

  Fly    84 ETCQRSYGHLRQFVGPVEVEQRPPEKKGSETATKLEPDVDP-----------DEAEQEPEHDEED 137
            :..::..|.:      :|:...|...|..:..:..|.|:|.           :||:|:.|.::|.
  Fly    66 QIARKLRGEI------LELIHSPYMSKDHKQTSYKEDDLDRETTISKFDGNIEEAQQQDEEEQEL 124

  Fly   138 EDVDLDESHYAEADDAAETQGGVFHDEIEDGILVELEKDRIVHVKNEQVEEDGIIEEVYDVYETY 202
            |.|....:....|                 ||:.|:.::....:..:..|||..  ...|:....
  Fly   125 ESVGTTVTLVGPA-----------------GIVEEVAEEEHTFIIKQSEEEDEF--HSVDLELDI 170

  Fly   203 EGDLIPDQGYDHEMADQA--LSELSAEIEYLDQVEHDQLTESAHEDDAEVDLNSTEEEFVPSKSV 265
            :.::|.::...||:.:.|  :.|::.|||..|.:.||: .|:..||..:.|..|..:|.:..   
  Fly   171 DNEIIINEEEAHEVEEVAHEIEEVAHEIEEEDLLPHDK-QEAQEEDFFKEDTMSDFDEHLDG--- 231

  Fly   266 RASIHARNATKRRVNPRRSATSTASVAVESSTSKTTDRGNPLKVRRGNSDSAGSKMSIK----SE 326
                                      |:|...|...|:      .:.|..|....::|:    .|
  Fly   232 --------------------------AIEYIISDGEDQ------EQDNESSGEYTVNIQCPSCPE 264

  Fly   327 KDISIGEVLARKHSGIKTKGGHKILLGDKKEFK-YICDVCGNMYPSQSRLTEHIKVHSGVKPHEC 390
            |..|      |:...:.||..|         |. |:||.||....|.|....|::.|..||...|
  Fly   265 KFSS------RRAYNVHTKREH---------FPGYVCDQCGKTLQSYSGFIGHLQNHEPVKQFAC 314

  Fly   391 EICGHCFAQAQQLARHMNTHTGNRPYKCSYCPAAFADLSTRNKHHRIHTNE-RPYECDVC-HKTF 453
            .:|...|::..:|..||..|:|..||:|..|...|.......||..||.:| :..||.|| .||.
  Fly   315 PVCPERFSRKFRLKHHMAWHSGETPYQCDVCSKRFVHKVALYKHKMIHDSETKRLECQVCGFKTR 379

  Fly   454 TYTNTLKFHKMIHTGEKPHVCDVCGKGFPQAYKLRNHRVIHERRG 498
            |..: |:.|...|||:||..|.||.|.|.|.|.::.|...||..|
  Fly   380 TKAH-LERHMRSHTGDKPFACPVCNKRFSQMYNMKAHLREHESPG 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 13/75 (17%)
C2H2 Zn finger 362..382 CDD:275368 7/19 (37%)
zf-H2C2_2 375..399 CDD:290200 7/23 (30%)
COG5048 386..>447 CDD:227381 20/61 (33%)
C2H2 Zn finger 390..410 CDD:275368 6/19 (32%)
zf-H2C2_2 403..426 CDD:290200 9/22 (41%)
C2H2 Zn finger 418..438 CDD:275368 5/19 (26%)
zf-H2C2_2 432..455 CDD:290200 11/24 (46%)
C2H2 Zn finger 446..466 CDD:275368 8/20 (40%)
zf-H2C2_2 459..481 CDD:290200 11/21 (52%)
C2H2 Zn finger 474..494 CDD:275368 8/19 (42%)
ZIPICNP_651765.1 C2H2 Zn finger 286..306 CDD:275368 7/19 (37%)
C2H2 Zn finger 314..334 CDD:275368 6/19 (32%)
zf-H2C2_2 327..351 CDD:290200 10/23 (43%)
C2H2 Zn finger 342..391 CDD:275368 17/49 (35%)
zf-H2C2_2 383..408 CDD:290200 12/25 (48%)
C2H2 Zn finger 399..419 CDD:275368 8/19 (42%)
C2H2 Zn finger 432..449 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I2552
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.