DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4936 and Zscan26

DIOPT Version :9

Sequence 1:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001334420.1 Gene:Zscan26 / 432731 MGIID:3531417 Length:466 Species:Mus musculus


Alignment Length:440 Identity:112/440 - (25%)
Similarity:162/440 - (36%) Gaps:101/440 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 RETCQRSYGHLR--QFVGPVEVEQR---------PPEKKGSET----------ATKLEPDVDPDE 126
            :|...:.:..||  :..||.||.:|         .||....|.          .|.|..|:....
Mouse    38 QEPLCKQFRQLRYEESTGPREVLRRLRELCRQWLRPETHSKEQILELLVLEQFLTILPRDLQVQV 102

  Fly   127 AEQEPEHDEE----DEDVDLDESHYAEADDAAETQGGVFHDEIEDGILVELEKDRIVHVKNEQVE 187
            .|..||..||    .||:.||.....|..|:|:..        ...:||.....|     .|..|
Mouse   103 LEHHPETGEELVGILEDLQLDRGKAGEQKDSAQRS--------RPTVLVGEPAPR-----REARE 154

  Fly   188 EDGIIEEVYDVYETYEGDLIPDQGYDHEMADQALSE---LSAEIEYLDQVEHDQLTESAHEDDAE 249
            :.|.              .:|.:  ..|...:..||   |.|..:...::|.........|...|
Mouse   155 QPGC--------------ALPQK--PEERGKETRSENGNLIAGTDSCGRMESSCTMTEPIEAQCE 203

  Fly   250 VDLNSTEEEFVPSKSVRASIHARNATKRRVNPRRSATSTASVAVESSTSKTTDRGNPLKVRRGNS 314
             ||:..:...:|.:...:..   ..||.|:             |::|.....||.:..::   :.
Mouse   204 -DLSLKKNPAMPKEKTNSQC---LETKERL-------------VQNSGLIEHDRAHTGEM---SW 248

  Fly   315 DSAGSKMSIKSEKDISIGEVLARKHSGIKTKGGHKILLGDKKEFKYICDVCGNMYPSQSRLTEHI 379
            :|.||:.|:            |..|..|....||.            |..||.::...|.|..|.
Mouse   249 ESVGSQSSV------------AADHQEISKDKGHP------------CQECGKVFQRSSHLIRHQ 289

  Fly   380 KVHSGVKPHECEICGHCFAQAQQLARHMNTHTGNRPYKCSYCPAAFADLSTRNKHHRIHTNERPY 444
            |:|.|.||::|:.||..|:|...|..|:..|||.:||.|.:|...|...|..|:|.:||:.:.|.
Mouse   290 KIHLGEKPYQCKECGKVFSQNAGLLEHLRIHTGEKPYLCIHCGKNFRRSSHLNRHQKIHSQDEPR 354

  Fly   445 ECDVCHKTFTYTNTLKFHKMIHTGEKPHVCDVCGKGFPQAYKLRNHRVIH 494
            ||..|.|||:....|..|:.:|...|.|.|:.|||.|.....|..|..||
Mouse   355 ECKECGKTFSRALLLTHHQRVHGRSKRHHCNECGKAFSLTSDLIRHHRIH 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 3/13 (23%)
C2H2 Zn finger 362..382 CDD:275368 7/19 (37%)
zf-H2C2_2 375..399 CDD:290200 11/23 (48%)
COG5048 386..>447 CDD:227381 24/60 (40%)
C2H2 Zn finger 390..410 CDD:275368 7/19 (37%)
zf-H2C2_2 403..426 CDD:290200 9/22 (41%)
C2H2 Zn finger 418..438 CDD:275368 6/19 (32%)
zf-H2C2_2 432..455 CDD:290200 11/22 (50%)
C2H2 Zn finger 446..466 CDD:275368 7/19 (37%)
zf-H2C2_2 459..481 CDD:290200 9/21 (43%)
C2H2 Zn finger 474..494 CDD:275368 7/19 (37%)
Zscan26NP_001334420.1 SCAN 43..151 CDD:413396 28/120 (23%)
COG5048 <253..463 CDD:227381 59/176 (34%)
C2H2 Zn finger 272..292 CDD:275368 7/19 (37%)
C2H2 Zn finger 300..320 CDD:275368 7/19 (37%)
C2H2 Zn finger 328..348 CDD:275368 6/19 (32%)
C2H2 Zn finger 356..376 CDD:275368 7/19 (37%)
C2H2 Zn finger 384..404 CDD:275368 7/19 (37%)
C2H2 Zn finger 412..432 CDD:275368
C2H2 Zn finger 440..460 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4340
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.